Gene or accession: CG8769
Gene annotation error
Gene CG8769 should be split.
Comments: This is a member of a small family of OBP-like proteins (13 members;
odorant binding protein-like) I have recognized in the genome sequences. I
suggest two changes. First, the cDNA as predicted is correct and needs to be
translated from nearer the 5' end. Second, the long third intron is probably
not correct for several reasons. First, it is poorly predicted. Second, it
is very long while almost all the introns in these proteins are very short.
Third, this is the only member of the family predicted to have a long
C-terminus. Fourth, this C-terminal region has a good EST match, which none
of the others in the family have. I would recommend ending the OBP-lik
protein shortly into the third intron, and then splitting the remainder off as
a separate gene. My amino acid translation of the OBP-like protein is
MLSKSQLLLLVVGFCLNAAVSADVDCSKRPSFVNPKTCCPMPDFVTAELKQKCIKFDMTPPPPPDGEASGSFESKRRHHH
PHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQEVFEDSSDLQTTATQAFTTCATKVADFEANLPPRPAPSPPPGFPMCP
HDAGHLMGCVFRNMMKNCPDSIRNDSQQCTDMKEFFTKCKPPRGPPPSAEDIVRHPRKILFVZ