Gene or accession: CG10742
Gene annotation error
Gene CG10742 has incorrect exon/intron structure.
Comments: We have sequenced a BDGP cDNA, GH15125, which agrees with your
annotated cDNA, however this is a strange cDNA because there are two start
codons in other frames before the ORF. Furthermore, we propose that instead
of starting translation with the first start codon of the ORF, you employ the
third start codon. This provides a N-terminus that aligns in sequence and
length much better with the other tetraspanins. Our translation is
MHPHHFTYVSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLVMILAGTDIFLVSFSG
CVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSN
SGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVI
AGNALGIALIQLLVIYLAKTLEGQIELQKSRWLA