Gene or accession: CG10844 Gene annotation error I have new supporting evidence or functional assignment for gene FBgn0011286; Rya-r44F; CG10844. Comments: Celera Sequence for Rya-r44F is AE003835; AAF59036.1 Annotation of DNA is missing 4 known isoforms 1025-1059; VRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFR \-> SANAPGLRICLGSSDGRRNGGTSGRGTTPQVRRIP ISOFORMS 2, 3, 4 AND 5. 1115-1145; VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ \-> EEKVYGGVSESFGKQCGPGDIVGVFLDLADH ISOFORMS 3 AND 4 1856-1869; MISSING ISOFORMS 4 AND 5). for sequence of isoforms see: D17389; BAA04212.1 D17389; BAA41469.1 D17389; BAA41470.1 D17389; BAA41471.1