Subject: FlyBase query
Dear Dr. Ranson,
I am curating your paper for FlyBase:
Ranson et al., 2001, Biochem. J. 359: 295--304
In this paper you compare insect GSTs, including Drosophila ones.
You say in the Materials \+ Methods that:
'Two putative full-length transcripts were dervied from the annotations
for CG12930 and CG6673. The derived amino acid sequences of both of
these were included in this study (denoted by A and B)'.
Do you have the amino acid sequences of CG12930A, CG12930B, CG6673A and
CG6673B ?
If you could send me the sequences I would be able to figure out which
of the transcription units in FlyBase these correspond to \- the
structure of the CGs is changing as Release 3 of the genome annotation
is just about finished (for example 'CG12930' has been split into 2
separate genes), so I'd like to be able to figure out which of the new
release 3 transcripts your amino acid sequences correspond to if
possible,
thanks,
Gillian
\--------------------------------------------------------------
Gillian Millburn.
FlyBase (Cambridge),
\--------------------------------------------------------------
Subject: Re: FlyBase query
Dear Gillian,
Sorry for the delay in replying to your request. I have pasted the
putative amino acid sequences of the Drosophila GSTs, CG12930A and B
and CG6673A and B below. I have also included the other putative GSTs
whose amino acid translations were modified from those contained in
release 1 of flybase. The modifications are described in the
materials and methods of the same Biochem J. manuscript.
..
please note these annotations were done based on
alignments and studying of intron exon boundaries. The putative cDNA
sequences have not been confirmed experimentally.
Please let me know if you need any further information.
Hilary
>CG12930B
mskaikyyyd flsqpsralw iamklgktpf edcpvalrkq eqltdeyrsi nrfqkvpaiv
dgkfqlgesv sivryladkg vfseqlypkt leerarvdef lewqhfnvrl
vcslffrqvw llpakglapa pkpesvkkli
kdvesnlgllerlwlelkdflvgdkltvadifgsseinqynvnekqfpkvakwmerdatnpyydeahsfvyktsqq
avkakn
>CG12930A
mskpirfyyd llspiarglw iglkfsnspv
eycpialrkf eqltdeykki nrfqkvpaiv ggdfhlseti aiiryladkg qfdeklypkt
lenrarvdef lewqhlnirl acsmyfrdaw lfpmngiapk pkpeqiqali egvennlgll
erlwlendfl vgknltmadi
lgsseinqrvdekkfpkvvkwlervrvsanpyhdegltfidrkskqstaakl
>CG1702
msapiryyyd lmsqpsralf
iifrlsnmpf edcvvalrng ehltedfkke inrfqrvpci hdngyklaes vailrylsak
gkipehlypk yfvdqsrvde flewqhmslr ltcamyfrtv wleplltgrt pseakietfr
mqmernldvv eevwlegkdf ltgssltvad ifaaceieqt rmadydvrik ypkirawlkr
vrqscnpyyd vahefvykis gtgpqakl
>CG17639
msppvlyyl ppsppcrsil llakmldidf elkivnileg
eqlkpdfvam npqhcvptmn deglvlwesr ailsylvaay gksdqlyptd irvralvdqr
lqfdlgtlym rltdyyfptm figapldegk raklaeavgw lntilegrqf saadhftiad
ltllvtvsql eafefelrpy khirqwldrc kdhmapfdye elnankanml admfkakmnq
sag
>CG10065
mklyavsdg ppslavrmtl kaldiqyqli
nvdfcamehr seeyskmnpq keipvldddg fylsesiaim qylcdkyapd stlypqdvnv
ravinqrlcf nmgfyyapis ahsmapiffd ykrtpmslkk vqnaldvfet ylqrlgtkya
agenitiadf alisaticle ainfdlhqft lvnkwyetfk veypqlweia nsgmqeisaf
eqnppdmshm ehpfhptrks mglkl
>CG6673A
malpqkhfkrgspkpeipedgvlryysmrfcpysqraglvlaakkiphhtvyidlsekpewyidysplgkvpaiqlpnlp
gqpalveslviaeyldeqypgegslfpkdplqkaldrilierlspavsaiypvlftknppadaiknfetaldvfeqeitk
rgtpyfggnkigiadymiwpwferfpalkytldepyeldktryqnllkwrdlvaqdeavkataldarihakfmktrhenk
pdydvafqpl
>CG6673B
mlflpfqlgfgstkpelpedgvprffsmafcpfshrvrlmlaakhiehhkiyvdliekpewykdfsplgkvpalqltgvk
dqptlvesliiaeyldqqypqtrlfptdplqkaldkilierfapvvsaiypvltcnpnapkdaipnfenaldvfevelgk
rgtpyfagqhigivdymiwpwferfpsmkinteqkyeldtkrfekllkwrdlmtqdevvqktaldvqlhaefqksktlgn
pqydiafkgtp
>CG1681
msqplkfyfdflnqssralyilleaskipfeaipismlgehltgefrdnvnrfrklpaitdhgyqlsenvaifrhlarek
lvpehwyprrhlgrsrideylawqqtnmgvatteyfqqkwlvpylqktrpadnavnlaskqlehtlnefeqlflnsrkfm
mgdnisyadlsaiceidqpksigynafqnrnklarwyetvreelgphykevlgefeaklkgsgsgqqqgvaqavkq