Gene or accession: CG7105
Release: 2
Missed gene
Protein sequence:
>Proct (CG7105)
MGVPRSHGTGIGCGSGHRWLLVWMTVLLLVVPPHLVDGRYLPTRSHGDDLDKLRELMLQILELSNEDPQQQQQQQQQQQ
HPQLRLHNEATGGSSSSSNINNPRVSNGNSNAAWLQKLSAMGALDELGGDGARFGPNYGRY
Comments: We believe that the start Met has been wrongly predicted. There is
a much better Kozak Consensus sequence for the translation initiation codon at
nt 317 of the cDNA. Changing the start Met in this way does not alter the
predicted signal peptide cleavage site at VDG-RY , but does give a much better
score.
We have submitted a paper for publication describing the identification of
CG7105 as the gene encoding the insect neuropeptide, proctolin. We have given
the gene name Proct for CG7105.
Details have been submitted to EMBL (accession number AJ458447) to be released
later this month.