Gene or accession: CG10052 Release: 3 Gene annotation error Gene CG10052 has incorrect exon/intron structure or translation start site. Comments: Rx translation has been much improved (AE003452; AAF46639) but an old problem remains at an internal exon-intron splice site. Eggert et al., Proc. Natl. Acad. Sci. U.S.A. 95:2343-2348 (1998) translation in AJ223300; CAA11241 has a frameshift: release 3 PLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHG Eggert PLLSALPGFLSHPQTVYPSYLTPQPGARKSDHEQS--GGHGPPPCPQWAAAPHVGHGGHG but also you have an incorrect splice site relative to this sequence release 3 VRVQFIPPFIFQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSP Eggert VRV--------QVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSP thanks Nellie