Gene or accession: CG1339 Release: 3 Gene annotation error Gene CG1339 has incorrect exon/intron structure or translation start site. Comments: new translation (AE003840; AAF59215.3) has 1 amino acid difference to the translation provided by Hugh Robertson. The error is at a splice site so I was wondering if the error it with the reannotation or Hughs original prediction. G43B_DROME LLIAMVLENE-HTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTIST AAF59215 LLIAMVLENEQHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTIST thanks Eleanor