The following information accompanied stocks donated to the Bloomington Stock Center by Geoff Stilwell, Massachusetts General Hospital. An EMS screen for dominant picrotoxin-resistance mutations at Cambria BioSciences produced three Rdl mutations in a Canton-S background. RdlCB1 causes an A301S amino acid substitution. This is the same amino acid change present in RdlMD-RR, although it has been described as A302S in print. The relevant residue is flanked by asterisks in the following Rdl sequence: MSDSKMDKLARMAPLPRTPLLTIWLAINMALIAQETGHKRIHTVQAATG GGSMLGDVNISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLS EVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGSEFIKNIWVPDTFF VNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDR QLCHIEIESFGYTMRDIRYFWRDGLSSVGMSSEVELPQFRVLGHRQRAT EINLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVVISWVSFWLNRN ATPARV*A*LGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMV FASLLEYATVGYMAKRIQMRKQRFMAIQKIAEQKKQQLDGANQQQANPN PNANVGGPGGVGVGPGGPGGPGGGVNVGVGMGMGPEHGHGHGHHAHSHG HPHAPKQTWDPCSRR RdlCB2 (FBal0191494) causes a V304M substitution. Homozygous larvae are viable, but flies die before eclosion. RdlCB-2L causes a M267I substitution.
