FB2026_02 , released June 18, 2026
Aberration: Dmel\Df(4)Mpv17T
Open Close
General Information
Symbol
Df(4)Mpv17T
Species
D. melanogaster
Name
FlyBase ID
FBab0049509
Feature type
Computed Breakpoints include
Sequence coordinates
Member of large scale dataset(s)
Nature of Aberration
Cytological Order
Progenitor
Breakpoints
Carries alleles
Transposon Insertions
Formalized genetic data
Genetic mapping information
Comments

Frameshift deletion (20bp) of 4:1029027..1029046 resulting in the addition of AAGRYQNAGRPDPFCATLYHGHVFFGATLQRRAHRPNPAAHS after valine 68 of the only Mpv17 isoform and premature truncation following these novel amino acids. This deletion also affects asRNA:CR44031 on the opposite strand: the deletion is within the second exon of asRNA:CR44031 resulting in the loss of bases 338 through 357 of the asRNA:CR44031 RA transcript and bases 366 through 385 of the RB transcript.

Comments on Cytology
Sequence Crossreferences
DNA sequence
Protein sequence
Gene Deletion and Duplication Data
Genes Deleted / Disrupted
Complementation Data
Completely deleted / disrupted
Partially deleted / disrupted
Molecular Data
Completely deleted
Genes NOT Deleted / Disrupted
Complementation Data
 
Molecular Data
 
Genes Duplicated
Complementation Data
Completely duplicated
Partially duplicated
Molecular Data
Completely duplicated
Partially duplicated
Genes NOT Duplicated
Complementation Data
 
Molecular Data
 
Affected Genes Inferred by Location (0)
    If no genes are listed here, it may be because the affected region is very large. The JBrowse insert above may show an error for the same reason, and other FlyBase tools such as CytoSearch may also fail for large regions. You can contact FlyBase for more help.
    In these cases, there will be no "Export to Hitlist" button to the left.
    Phenotypic Data
    In combination with other aberrations
    NOT in combination with other aberrations
    Stocks (1)
    Notes on Origin
    Discoverer
     
    Balancer / Genotype Variants of the Aberration
     
    Separable Components
     
    Other Comments
     
    Synonyms and Secondary IDs (1)
    Reported As
    Symbol Synonym
    Df(4)Mpv17T
    Name Synonyms
    Secondary FlyBase IDs
      References (1)