121bp deletion in pcs exon 4, within the coding sequence. This results in a frameshift, replacing P237 to stop476 with 35 amino acid residues ARCLWAQKLPKQLPKLKMRKMPATTMKREPGSSEV.
121bp deletion in pcs exon 4, within the coding sequence. This results in a frameshift, replacing P237 to stop476 with 35 amino acid residues ARCLWAQKLPKQLPKLKMRKMPATTMKREPGSSEV. Site of deletion in mutant inferred by FlyBase curator based on reported amino acid change.
The pupal eye photoreceptors of pcsΔ1 homozygotes exhibit smaller rhabdomeres and cytoplasmic vesicle accumulations, as compared to controls; the cisternae of Golgi units appear slightly swollen, but are still stacked well; mitochondria and ER are normal.