4bp deletion within the pcs coding sequence. This results in a frameshift, replacing S273 to stop476 with 38 amino acid residues LRAARCLWAQKLPKQLPKLKMRKMPATTMKREPGSSEV.
4bp deletion within the pcs coding sequence. This results in a frameshift, replacing S273 to stop476 with 38 amino acid residues LRAARCLWAQKLPKQLPKLKMRKMPATTMKREPGSSEV. Site of deletion in mutant inferred by FlyBase curator based on reported amino acid change.