Frameshift deletion (8bp) of 4:1029022..1029029 and SNP 4:1029021 C to G resulting in the addition of RGRYQNAGRPDPFCATLYHGHVFFGATLQRRAHRPNPAAHS after serine 73 of the only Mpv17 isoform and premature truncation following these novel amino acids. This deletion also affects asRNA:CR44031 on the opposite strand: it results in the loss of bases 333 through 340 of the asRNA:CR44031 RA transcript and bases 361 through 368 of the RB transcript.