Open Close
General Information
Symbol
Dmel\dl-PA
Species
D. melanogaster
Annotation Symbol
CG6667-PA
FlyBase ID
FBpp0080558
Associated gene
Length (aa)
677
Theoretical pI
8.10
Predicted MW (kDa)
75.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFPNQNNGAAPGQGPAVDGQQSLNYNGLPAQQQQQLAQSTKNVRKKPYVKITEQPAGKALRFRYECEGRSAGSIPGVNST
PENKTYPTIEIVGYKGRAVVVVSCVTKDTPYRPHPHNLVGKEGCKKGVCTLEINSETMRAVFSNLGIQCVKKKDIEAALK
AREEIRVDPFKTGFSHRFQPSSIDLNSVRLCFQVFMESEQKGRFTSPLPPVVSEPIFDKKAMSDLVICRLCSCSATVFGN
TQIILLCEKVAKEDISVRFFEEKNGQSVWEAFGDFQHTDVHKQTAITFKTPRYHTLDITEPAKVFIQLRRPSDGVTSEAL
PFEYVPMDSDPAHLRRKRQKTGGDPMHLLLQQQQKQQLQNDHQDGRQTNMNCWNTQNIPPIKTEPRDTSPQPFGLSYRAP
PELTPSPQPLSPSSNYNHNSTPSPYNMASAVTPTNGQQQLMSPNHPQQQQQQQQYGATDLGSNYNPFAQQVLAQQQQHQQ
QQQQHQHQHQQQHQQQQQQQQQQQQQSLQFHANPFGNPGGNSWESKFSAAAVAAAAATATGAAPANGNSNNLSNLNNPFT
MHNLLTSGGGPGNANNLQWNLTTNHLHNQHTLHQQQQLQQQQQQQYDNTAPTNNNANLNNNNNNNNTAGNQADNNGPTLS
NLLSFDSGQLVHINSEDQQILRLNSEDLQISNLSIST
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0081005
2489
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081006
2833
FBtr0081007
4724
FBtr0301383
2590
FBtr0301384
2504
FBtr0340250
4481
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0080559
677
FBpp0080560
999
FBpp0290597
677
FBpp0290598
677
FBpp0309222
999
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Name Synonyms
Secondary FlyBase IDs
    References (1)