Open Close
General Information
Symbol
Dmel\msn-PD
Species
D. melanogaster
Annotation Symbol
CG16973-PD
FlyBase ID
FBpp0089311
Associated gene
Length (aa)
1102
Theoretical pI
8.06
Predicted MW (kDa)
120.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAHQQQQQLAPSVNCSLDDIDLTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVL
KKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRD
IKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPL
CDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRK
QEKEREDYRYSGSDNDDDEPQLAGEHSSIVQAPGGDTLRRNFQQIQEGRLAAEQQQQHHLMAQAQAQAAAAHAAAQAQAQ
LQQQQQQAAAAAAAAAHAAQQAQQAAQQAQAQQPQANRQPKPPSRQQVEEPGPPARPPQRLIVVPDPPHANRPLPPTPKC
GEPAGQTPQQQQRNSQNNFKPSLPPRRPEDHLDVLAAQLSELGVVFSQQPQPQTAAGGQGSQQQAQPEAPPRNNRQSSGL
SSSGGSASGGGGSSKPAAALPQQSNNHLGQPVNPLDPLDSSDSDSEPDEPNDRARNDGTLLASDPPKPLPGLGPVSEDAN
TTTPLSHGSGGPPNRPLPPTPDDDDQAGDRTLIMKRNRGGGGGGGGGGGGGGSSGVGADGTGLGTPGTRTSSVLPDLLSQ
ASPATPPRHDKSSSEEKQRSFLTFGFGAGGSGPSRRESHVNVNVTPTSHEAANDTPEIRKYKKRFNSEILCAALWGVNLL
IGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINV
GDLQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAV
DLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWG
NKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072958
5206
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072956
6418
FBtr0072957
5506
FBtr0072959
4268
FBtr0333362
5271
FBtr0333363
4282
FBtr0333364
4618
FBtr0333365
5643
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072830
1504
FBpp0089310
1200
FBpp0089312
1102
FBpp0305554
1404
FBpp0305555
1101
FBpp0305556
1213
FBpp0305557
1200
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG16973-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)