Open Close
General Information
Symbol
Dmel\Dgk-PI
Species
D. melanogaster
Annotation Symbol
CG34361-PI
FlyBase ID
FBpp0300814
Associated gene
Length (aa)
747
Theoretical pI
8.21
Predicted MW (kDa)
82.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRWELRYGWQIVTFRTNCATAAAVACHQLLCPVSLTSAVEIMPNSFPPEGRRRERRSGNLVLRAGCCCIGKYFATHFQIT
PPDELSCPLLVFVNPKSGGRQGDRILRKFQYMLNPRQVYDLSKGGPKEGLTLFKDLPRFRVICCGGDGTVGWVLEAMDSI
ELASQPAIGVIPLGTGNDLARCLRWGGGYEGENIPKLMDKFRRASTVMLDRWSIEVTNTPHSDDMRPKVTLHSNMQKVIE
LSQSVVVDKSLMERFEEIQRQSKQVATSMGTAASSTSIMMASKTETEMETMATMEFGSSTTTTNRTTTTKSISMSTFETQ
CLQQTLRTAMSSSSSNTSSGSPCNGNQDAETEVDSHAAAAADVREKSVPRRSGETEKQSLETLLLQHKQQMQQQQQQQQQ
GVTSLAVEEAATATPVGSNQSDNSSQRNKQNNILKQQITLSLDLSDHEDEPKDDGGGAGDGTKSNGNSIPATPATPITPT
TPNAASSVLQQQQQQHLQFEQQQKPIKVQSDKDCTVPYNIINNYFSVGVDAAICVKFHLEREKNPHKFNSRMKNKLWYFE
YATSETFAASCKNLHESIEIVCDGVALDLANGPHLQGVALLNIPYTHGGSNLWGEHLSQKRIRKSAGPFGKSKKLRAGDK
EFSATSFNSVDLSVAIQDFGDRLIEVIGLENCLHMGQVRTGLRASGRRLAQCSEVIIKTKKTFPMQIDGEPWMQMPCTIK
VTHKNQVPMLMAPRSEKGRGFFNLLCS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0308590
2923
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0112580
4450
FBtr0112581
4238
FBtr0112579
3152
FBtr0308589
6282
FBtr0330238
4214
FBtr0346954
4214
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0111492
1211
FBpp0111493
1108
FBpp0111491
791
FBpp0300813
1230
FBpp0303271
1139
FBpp0312418
1100
External Crossreferences and Linkouts ( 2 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Dgk-PI
Name Synonyms
Secondary FlyBase IDs
    References (0)