Open Close
General Information
Symbol
Dmel\dsx-PF
Species
D. melanogaster
Annotation Symbol
CG11094-PF
FlyBase ID
FBpp0308767
Associated gene
Length (aa)
427
Theoretical pI
7.97
Predicted MW (kDa)
44.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVSEENWNSDTMSDSDMIDSKNDVCGGASSSSGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQ
RVMALQTALRRAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAA
AAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSD
HGGSVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSGTSVITSADHHMTTVPTPAQSLEGSCD
SSSPSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQY
VVNEYSRQHNLNIYDGGELRNTTRQCG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339710
6941
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081759
4010
FBtr0081760
3627
FBtr0081761
3238
FBtr0330073
3621
FBtr0330074
4010
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081256
549
FBpp0081257
427
FBpp0081258
427
FBpp0303106
549
FBpp0303107
572
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
dsx-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)