Subject: (Fwd) fruitless Priority: normal . Dear Gillian I have more information on possible fruitless alternative splice forms. Comparing melanogaster with the Hawaiian species heteroneura (AH009210 and silvestris (AH009214). There is an exon within the transcript CG7689 which is an alternative 3' end of fru in the Hawaiian species (see Gene 2462000 143-149). This sequence is conserved in melanogaster as follows: The exon is position 46583 to 45996 (complimentary AE003722) and would be spliced from position 47113. Stop codon is at 45998 to 45996 The additional peptide seq is attached below VKKSEAFLGSTGNKSMHQMLLHQAVEAQLKSFQLHYQNEGLDSA MHRLLAQQQQHQEQQQQHQQQPHHSLGKSQSPAIPS GSAGGSSRKSGRFRANWLYQFEWLQYDERANTMFCRHCRKWS GELADIRTSFVEGNSNFRLEIVNHHNKCKSHRMCYERE LQEQQQHPMPSGSAGGSSKRRSPEIITINVGKNSA sincerely Terry Dr Terence Davis Department of Pathology University of Wales College of Medicine