Gene or accession: CG14307
Release: 1
Gene annotation error
Gene CG14307 has incorrect exon/intron structure or translation start site.
Comments: I have an annotation correction for gene CG14307. This gene is part
of the fruitless locus (FlyBase ID FBgn0004652) and is a single exon. This is
an alternative splice form of the fru gene called fru type E (see Usui-Aoki K,
Ito H, Ui-Tei K, Takahashi K, Lukacsovich T, Awano W, Nakata H, Piao ZF,
Nilsson EE, Tomida J, Yamamoto D. Formation of the male-specific muscle in
female Drosophila by ectopic fruitless expression. Nat Cell Biol. 2000
Aug;2(8):500-6.).
With reference to the genomic sequence AE003722 this exon is:
37789..37245
stop codon at 37243..37245
and splices from 45381
(these are complementary strand of AE003722).
The peptide sequence is below: this starts at nucleotide 37787 (37789-37788
are second and third bases of previous codon)
SKAWHMRLTFERLSGGCNLHRCKLCGKVVTHIRNHYHVHFPGRFECPLCRATYTRSDNLRTHCKFKHPMYNPDTRKFDN
LMSSSAVGAAATPTASQLAVASQAAMAAAAAAAFNAAQQQQQQQQQQQQHQHQQQQQHQQSQQQQQQQQQSQQQLHALA
QQHMLQLQPQHHQQQQHNATSE
Please note that the above peptide is longer than that from the given
reference and is a comparison from the type e protein in D. heteroneura. I
believe as the genomic sequence between melanogaster (AE003722) and
heteroneura (AF051664) are so similar that a mistake has been made with the
cDNA in the reference.
There is also a type d protein:
This is an extension of one of the exons in CG7689
Thus 45513..45373 (instead of 45513..45381)
Stop codon 453375..45373
This truncates the fru protein and it ends with aa VE (see above ref)
To summarise the various fru alternative 3' forms:
Type A: gene CG7689
Type B: gene CG7688
Type C: (see FBrf0129326)
Type D: (above)
Type E: gene CG14307