Open Close
General Information
Symbol
Dmel\Fak-PB
Species
D. melanogaster
Annotation Symbol
CG10023-PB
FlyBase ID
FBpp0085727
Associated gene
Length (aa)
1200
Theoretical pI
7.20
Predicted MW (kDa)
134.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNTAGATSQPPPTKNEINSEEYLIHVHMPNKSFKAVRFNVKETVFHVIRRTVEDLGTDGRTPSIQRYACRMLNMITKEVI
WLARSTSMQKVLSHILTPGCSNVDCPNNQSELDEVLLEHGRRITDNRVWRVELRVRYVPNNIQELFEEDKATCFYYFNQV
KEDFIQANVTAIDTEVAVQLCCLGIRHYFKNITVKAPDKKQHIDYIEKEIGFKSFLPQSVIATSKPKNLKKLIQVGYKKV
YNYNDIEYLTRFFDLLKNIYLTNFEQFSVTLSSAWNISGILHVGPHIGISYQTHPQASLKNVAQFKDVVSIKTCTLPKEK
LSKSGENTTEPELQNFNCNCQKIKTQIKISASNNVEDLVITCNGINTAESIADLIDGYCRLLSKDLEFTIWHRETNASNE
DSAKALPNDATLGSNKSTSSQGKPMLTDDYAEIGLLEGEGDYSTPTVRNYELDRALITPSAKIGVGQFGDVYVGTYTLPK
LGKGKNLAGNGKNSNSDQRNADSRPDVIQVAIKTCKANDDPEKTENFLAEAYIMQKFDHPHIIRLIGICSVMPIWIVMEL
AKLGELRAYLKTNSERLSHGTLLKYCYQLSTALSYLESKKFVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYYHSTP
TVALPIKWMSPESINFRRFTTASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQCWA
YEPLKRPNFKRIKETLHEILIEDSINSSETLKREQRKVASMSWIGSDDIDIPPSKPSRVMHDPDITGLMPETTGLPQTYI
IAQNPAVLAKLMMENQKRGINPAAYTTPASGIHNVLGEKLRQQQKDSNSDSEWLIQEELLRQRSCSIPQGSLNDHQAQMF
KLDFMSAGPSSLPDCSNSSSRPMTPNANLSSLKSNHSSADHLSSLTSAEEQMGSNARNLGSAVPSRPPNRADDEVYCATT
LVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISIIFPAQALKEVQMAHQVLSKDMHELVSAMRLAQQYSD
TTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLFPPSATKETSCSSSFESTSGSIVAEPVNDLGGYIKTSTSGD
LLQNTGIYDNDLHHSFNSQLQLQNPKASIDLSGGGSLQRGMSLGLDTTRSTNEPLRIVEETLGSPGEHMYCNTSALHGHA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0086543
4499
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0086542
4713
FBtr0086544
4240
FBtr0114605
5613
FBtr0301882
4707
FBtr0301883
4142
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085726
1200
FBpp0085728
1200
FBpp0113097
1500
FBpp0291096
1198
FBpp0291097
1200
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG10023-PB
Fak-PB
Fak56D-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)