Open Close
General Information
Symbol
Dmel\CaMKII-PL
Species
D. melanogaster
Annotation Symbol
CG18069-PL
FlyBase ID
FBpp0305830
Associated gene
Length (aa)
522
Theoretical pI
7.33
Predicted MW (kDa)
59.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSI
QEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGL
AIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMI
TKKGEGSQVKESTDSSSTTLEDDDIKDKKGTVDRSTTVVSKEPEDIRILCPAKTYQQNIGNSQCSSARRQEIIKITEQLI
EAINSGDFDGYTKICDPHLTAFEPEALGNLVEGIDFHKFYFENAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAH
THQSEETRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0333674
3855
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089218
3589
FBtr0089219
3730
FBtr0089217
3759
FBtr0100146
3879
FBtr0100147
3816
FBtr0100148
3837
FBtr0300377
2371
FBtr0300378
3775
FBtr0300379
1845
FBtr0333673
3735
FBtr0333675
3801
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088282
490
FBpp0088283
509
FBpp0088281
490
FBpp0099496
530
FBpp0099497
509
FBpp0099498
516
FBpp0289606
490
FBpp0289607
530
FBpp0289608
531
FBpp0305829
482
FBpp0305831
504
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CaMKII-PL
Name Synonyms
Secondary FlyBase IDs
    References (0)