Gene or accession: New gene
Release: 1
Missed gene
Comments: Within the first intron of the current truncated annotation of
DmNCad2, or CG7527, there is a short ORF in the same transcriptional
orientation that encodes a 187aa protein with highly significant similarity to
the two intron gene/protein CG8580, and then in turn convincing and
significant similarity to a pair of mammalian proteins, and using PSI-BLASTP,
eventually similarity to similar short proteins in C. elegans and perhaps
plants and fungi. Seemingly a second member of a small family of short
proteins of no known function. The amino acid sequence is
MSHITRKRLLTLDEESQHINSTKRCGSNCIEKMLTKWSRQSIPGVNSISRKRSFPWEDNSPDIFPAKHSRKHIIKKKSK
TIHEPEVPIDFLMGLPVLLDSDFSDSEECRPKSEIHVAKPETEDNRDLFTYQQLKLMCCEMMKQCEDRVVLEYEIALTQ
KMAEQYDTFIKFNHDQLQRECEHRASYLS