The following information accompanied stocks donated to the Bloomington Stock Center by Julian Ng, University of Cambridge.
P{UAS-Eb1.TagRFP.Halo2} expresses the E isoform of Eb1 protein fused at its C-terminus to tagRFP and Halo2 under UASt control. The fusion protein localizes to the cytoplasm.
P{UAS-Eb1.Halo2} expresses the E isoform of Eb1 protein fused at its C-terminus to Halo2 under UASt control. The fusion protein localizes to the cytoplasm.
P{UAS-Lifeact.SNAPf} expresses the Lifeact peptide (MGVADLIKKFESISKEE) fused at its C-terminus to SNAPf under UASt control. The fusion protein localizes to the F-actin.
P{UAS-myr.SNAPf.HA.Citrine} expresses the Src myristoylation tag (amino acids 1–85 of Src64B) fused at its C-terminus to SNAPf, an HA tag and Citrine YFP under UASt control. The fusion protein localizes to the cell membrane.
PBac{UAS-extra.SNAPf.CD2} expresses the signal peptide from the C. elegans pat-3 protein fused at its N-terminus to SNAPf and at its C-terminus to the rat CD2 transmembrane domain under UASt control. The fusion protein localizes to the extracellular surface. 
P{UAS-IMS.Halo2} expresses the mitochondrial inner membrane space localization peptide from LACTB (MYRLLSSVTARAAATAGPAWDGGRRGAHRRPGLPVLGLGWAGGLGLGLGLALGAKLVVGLRGAVPIQS) fused at its C-terminus to Halo2 under UASt control.
P{UAS-CLIPf.Tom7.HA} expresses the A isoform of Tom7 fused at its N-terminus to CLIPf and at its C-terminus to an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-SNAPf.Tom7.HA} expresses the A isoform of Tom7 fused at its N-terminus to SNAPf and at its C-terminus to an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.CLIPf} expresses the A isoform of Tom20 protein fused at its C-terminus to CLIPf under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.SNAPf.GFP.HA} expresses the A isoform of Tom20 protein fused at its C-terminus to SNAPf, GFP and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.SNAPf.HA} expresses the A isoform of Tom20 protein fused at its C-terminus to SNAPf and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-COX8A.SNAPf.HA} expresses the human COX8A protein fused at its C-terminus to SNAPf and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-COX8A.SNAPf.HA}attP2, P{UAS-Lifeact.SNAPf}attP2, P{UAS-myr.SNAPf.HA.Citrine}attP2, P{UAS-IMS.Halo2}attP2, P{UAS-CLIPf.Tom7.HA}attP2, P{UAS-SNAPf.Tom7.HA}attP2, P{UAS-Tom20.CLIPf}attP2, P{UAS-Tom20.SNAPf.GFP.HA}attP2, P{UAS-Tom20.SNAPf.HA}attP2 and P{UAS-Eb1.TagRFP.Halo2}attP2 are insertions into the P{CaryP}attP2 site at 68A4,  3L:11070538  (R6). 
P{UAS-Eb1.Halo2}attP40 and P{UAS-IMS.Halo2}attP40 are insertions into the P{CaryP}attP40 site at 25C6,  2L:5108448  (R6).
PBac{UAS-extra.SNAPf.CD2}VK00027 in an insertion into the PBac{y+-attP-9A}VK00027 site at 89E11,  3R:17052863  (R6).