FB2026_02 , released June 18, 2026
Reference Report
Open Close
Reference
Citation
Ng, J. (2019.9.3). Ng chemtag constructs and insertions. 
FlyBase ID
FBrf0243923
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
The following information accompanied stocks donated to the Bloomington Stock Center by Julian Ng, University of Cambridge.
P{UAS-Eb1.TagRFP.Halo2} expresses the E isoform of Eb1 protein fused at its C-terminus to tagRFP and Halo2 under UASt control. The fusion protein localizes to the cytoplasm.
P{UAS-Eb1.Halo2} expresses the E isoform of Eb1 protein fused at its C-terminus to Halo2 under UASt control. The fusion protein localizes to the cytoplasm.
P{UAS-Lifeact.SNAPf} expresses the Lifeact peptide (MGVADLIKKFESISKEE) fused at its C-terminus to SNAPf under UASt control. The fusion protein localizes to the F-actin.
P{UAS-myr.SNAPf.HA.Citrine} expresses the Src myristoylation tag (amino acids 1–85 of Src64B) fused at its C-terminus to SNAPf, an HA tag and Citrine YFP under UASt control. The fusion protein localizes to the cell membrane.
PBac{UAS-extra.SNAPf.CD2} expresses the signal peptide from the C. elegans pat-3 protein fused at its N-terminus to SNAPf and at its C-terminus to the rat CD2 transmembrane domain under UASt control. The fusion protein localizes to the extracellular surface. 
P{UAS-IMS.Halo2} expresses the mitochondrial inner membrane space localization peptide from LACTB (MYRLLSSVTARAAATAGPAWDGGRRGAHRRPGLPVLGLGWAGGLGLGLGLALGAKLVVGLRGAVPIQS) fused at its C-terminus to Halo2 under UASt control.
P{UAS-CLIPf.Tom7.HA} expresses the A isoform of Tom7 fused at its N-terminus to CLIPf and at its C-terminus to an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-SNAPf.Tom7.HA} expresses the A isoform of Tom7 fused at its N-terminus to SNAPf and at its C-terminus to an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.CLIPf} expresses the A isoform of Tom20 protein fused at its C-terminus to CLIPf under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.SNAPf.GFP.HA} expresses the A isoform of Tom20 protein fused at its C-terminus to SNAPf, GFP and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-Tom20.SNAPf.HA} expresses the A isoform of Tom20 protein fused at its C-terminus to SNAPf and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-COX8A.SNAPf.HA} expresses the human COX8A protein fused at its C-terminus to SNAPf and an HA tag under UASt control. The fusion protein localizes to mitochondria.
P{UAS-COX8A.SNAPf.HA}attP2, P{UAS-Lifeact.SNAPf}attP2, P{UAS-myr.SNAPf.HA.Citrine}attP2, P{UAS-IMS.Halo2}attP2, P{UAS-CLIPf.Tom7.HA}attP2, P{UAS-SNAPf.Tom7.HA}attP2, P{UAS-Tom20.CLIPf}attP2, P{UAS-Tom20.SNAPf.GFP.HA}attP2, P{UAS-Tom20.SNAPf.HA}attP2 and P{UAS-Eb1.TagRFP.Halo2}attP2 are insertions into the P{CaryP}attP2 site at 68A4,  3L:11070538  (R6). 
P{UAS-Eb1.Halo2}attP40 and P{UAS-IMS.Halo2}attP40 are insertions into the P{CaryP}attP40 site at 25C6,  2L:5108448  (R6).
PBac{UAS-extra.SNAPf.CD2}VK00027 in an insertion into the PBac{y+-attP-9A}VK00027 site at 89E11,  3R:17052863  (R6).
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference