Base change T735988A and frameshift deletion of 4:735989 (R6) resulting in the addition of EMALCSNQSSLNPRRKYWISEIKKIISTPTNQLY after glycine 887 of the bt RJ isoform and premature truncation after the novel amino acids.
Bases 4:735988 and 4:735989 of bt are replaced with an "A" leading to a frameshift and early translation termination after the additon of 34 novel amino acids (EMALCSNQSSLNPRRKYWISEIKKIISTPTNQLY).