Open Close
General Information
Symbol
Dmel\Prp39-PA
Species
D. melanogaster
Annotation Symbol
CG1646-PA
FlyBase ID
FBpp0084692
Associated gene
Length (aa)
1009
Theoretical pI
4.81
Predicted MW (kDa)
114.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVQEEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAELHSETSDDIKETRGQAGVDTL
LASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQMEKMNSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDEL
PLPSKPEINDAEEVSDEELPAPQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTK
DKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEKERKKLPDLDKYWRAVKEDST
DFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHV
KSNHGDDETFVRSQYERAVKACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVT
ITLANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDSKEREREKDKDKDKDKDKEKRETVGGGVGKSPKDTSET
QVDESDSTTDLTTESESSHAASKPAMQIDFSDLSTLNDEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHV
KPLERAQLKNWKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHHPDK
PSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCRELYKHYIESTKNKGIAGSLAIKYAR
FLNKICHDLDAGLAALQQALERDPANTRVALQMIDLCLQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDF
GSTARGLQDAQRALQQALTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQQNT
AAAYPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGYGNYY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0085323
3563
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085322
3405
FBtr0085325
3573
FBtr0113299
3582
FBtr0113301
4604
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0084691
1066
FBpp0084694
1009
FBpp0112211
1009
FBpp0112213
501
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG1646-PA
Prp39-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)