Five bp deletion in qsm results in a frameshift of the ORF at F17.
Inferred coordinates of a 5bp deletion that results in a frameshift inf qsm at F17. The aa sequence of the predicted protein is MLLSMQMWRSLWLAALRISPGQRFPQGALFGGSDEG*
qsmF17fs mutants exhibit epidermal invaginations or elevations on the notum at the muscle insertion sites of DLM (comma phenotype) and DVM (vortex phenotype), as well as a oblique wing. The anterior tendon cells of pupal DLMs show increased length.
qsmF17fs has visible | adult stage phenotype, enhanceable by dpyov1
qsmF17fs has visible | adult stage phenotype, suppressible | partially by Scer\GAL4sr-md710/RokKK107802
qsmF17fs has visible | adult stage phenotype, suppressible | partially by Scer\GAL4sr-md710/RokGD1522
qsmF17fs has visible | adult stage phenotype, suppressible by konNIG.10275R/Scer\GAL4Mef2.PR
qsmF17fs/qsmF17fs is an enhancer of visible | adult stage phenotype of dpyov1
qsmF17fs has notum phenotype, suppressible | partially by Scer\GAL4sr-md710/RokGD1522
qsmF17fs has notum phenotype, suppressible by konNIG.10275R/Scer\GAL4Mef2.PR
qsmF17fs has notum phenotype, suppressible | partially by Scer\GAL4sr-md710/RokKK107802
qsmF17fs has wing phenotype, non-suppressible by Scer\GAL4sr-md710/RokGD1522
qsmF17fs has wing phenotype, non-suppressible by Scer\GAL4sr-md710/RokKK107802
qsmF17fs is rescued by Scer\GAL4pnr-MD237/qsmUAS.cCa
qsmF17fs is rescued by Scer\GAL4sr-md710/qsmUAS.cCa
qsmF17fs is rescued by Scer\GAL4Mef2.PR/qsmUAS.cCa
qsmF17fs is partially rescued by qsmUAS.mCherry/Scer\GAL4pnr-MD237
qsmF17fs is partially rescued by Scer\GAL4sr-md710/qsmUAS.mCherry
qsmF17fs is partially rescued by qsmmut.UAS.mCherry/Scer\GAL4Mef2.PR
qsmF17fs is not rescued by qsmmut.UAS.mCherry/Scer\GAL4pnr-MD237
qsmF17fs is not rescued by Scer\GAL4sr-md710/qsmmut.UAS.mCherry