Open Close
Reference
Citation
McGill Drosophila Genome Project, (2001.9.25). FASTA sequences of Gene Predictions of the 38 region. 
FlyBase ID
FBrf0139855
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
FASTA sequences of Gene Predictions of the 38 region taken from the
McGill Drosophila Genome Project web page
(http://ww2.mcgill.ca/Biology/labs/MDGP/home.html) on 25.9.2001.
>38B.1
MAIISQCGCSSSICCVPRNQMTKPWQRRTKWKNINKEDRDNNRLCHFYAKQQTENYIHFL
LPASRSRTVVTKAAALSVWECRTKFGQITNILRGRHHYLGDIAQLIRHSSKANKKASPEN
DDKSLSILTNVPNVAQSRGTFHRPNAHLLARQIPNFHTNAGVVGRTPPGNWPTLPSNKSL
SGGHFRDIIVSLAKGRSGQNGAGKGKAKVNSIKAWTDRSEKRWMAVNCKW
>38B.2
MFHLKRELSQGCALALICLVSLQMQQPAQAEVSSAQGEHLVQPPPEKQSSKDSFLGTPLS
NLYDNLLQREYAGPVVFPNHQVERKAQRSPSLRLRFGRSDPDMLNSIVEKRWFGDVNQKP
IRSPSLRLRFGRRDPSLPQMRRTAYDDLLERELTLNSQQQQQQLGTEPDSDLGADYDGLY
ERVVRKPQRLRWGRSVPQFEANNADNEQIERSQWYNSLLNSDKMRRMLVALQQQYEIPEN
VASYANDEDTDTDLNNDTSEFQREVRKPMRLRWGRSTGKAPSEQKVCMNIRSFFCAQTKV
VLLPT
>38B.3=Barren
MTLPRLETPLRRSAVGSYQEGVSRMLTPFNDDEAERREARRRTLLQQHHRSSTLESIEDN
ETIKNCLELYNGNKVSKDNAWNLMLIDSLANLLDHHHKRMSNFKMAGSSLEASSKVYGLR
VDSIYLDAMRISAGLSARTLTDKQINAAEDDDGPQGEQATGEGQDSAQQAAKEAAPKPKR
QKKPISTVTKNRETLNSRLDTAPLQDPVFGKLNSTVGSINASNRLMHNILPSFDSELRLR
TTYNFWNSEESTEEVQDHTTLNAEMEQWPATSLMSTNLMRKLLPHAERSNLRPLHTGYII
TSAPNPKSANEKAAEVVQDEDHDEGLDNADDMCVNEISMAFDINAECEPMPDLDGPPPLV
LEVDSNELEELTAEEQMVINNCRRLRKQTEFIEDLRPVDGNSKLEYSYRPMDQISQFWAG
PSHWKFKRTRPRSTFSQTNGQVDTQPIRTQRAKKSAHLNANRRAKALDYGNVTENFFQQL
DTTIRQRKANFQKKWDPRKLILPTKFELDPDLFFKYESAPSIKLSKRAGEPDSDEGGDLG
IDMDADMHHDDDNDQELFNNEHFTDAVPANVSVIAAIAAEQAAEASMMNVSAGEIGLTQM
NATCNNTVFEIGTEFEGAPSQVAKVIVPFAKRAKVIDMKNLKKSCNSLIQKQLLNAVPEE
TIPSHPKKKGEHYSKGFASFQQVYQKLPDLLTTKMSDSLSPSVAFYAVLHLANDLKLRLI
PQEDLEDFQIRQVLD
>38B.4=loki
MARDTQGTQGTQSQASNIWTQVESQPMEKIVWGRLYGKNIKIKSLDLNNDEFTAGRGEAN
DLILTLNDLPEKILTRISKVHFIIKRANCELTNPVYIQDLSRNGTFVNNEKIGTNRMRIL
KNDDVISLSHPTYKAFVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTC
QQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVL
EFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEE
TLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCL
SGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQ
SSWLRDAPMLQKAKRLMKLDGMEIEEENFLEPPTKRSRR
>38B.5
MFPQRSSELYRTPVTHQPPPALELAGNLEYPNLNIADLNARLENLSPRLHDCWDSIAIND
HNHLALATNRREGRQWWGMLFGYGRDQMHHMSVDSANFKLQAEHTVNIVRYAEDDFLLVA
LGDTRLQAWSTYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLN
VCIKVMWMYGKYTNVTLLQVWDLSGADMVSTYRSRSSHTDKLTGLATPAASVDKFVTCDR
GGCARLWDVRAAAPSSTCLYADASHVLSFTSAAWAAASELQGDNHIYLGDYDGKVHTLDI
RVPRKLAETREYFDKGHVAQLLINGYKFKRNNDDLH
>38B.6
MGGGGLLDIYAMAWEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLF
KEYGRFVTPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRY
YPKFVKNDRKTFSWLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQR
>38B.7
MTLSRKDFQALLIVICFGFWIENLVQGADDYYVYSPVCQMPAVNPFTWDTMSNFHRKTLR
HCHNDSDMVTSEFDFETHQYRLHVHEHLAKPIMNRKGNATLECEYQEISRDNSDQKPDNA
YNQLRRRPIEQHQFVPNNTDYMITSCYVRDVTKHRELLQQDAISFIEDRLPKEKVKDFVK
DESEVHKPSVLIMGLDSTSRINLRRAMPSVYKFVRQPGWFEMQGYNKVGDNTFPNLLAAL
TGDSEKGVGDYCDVTKPGCLDSLNFIWKRFKKANYTTAFAEDCSSISTFNYLKPGFVKQP
TDYYLRPLLFAIEKQFKVTNDFGFAYCVGRHLSFSYVWDFGQQFIDRFLGRSPMFGFLWS
NSFTHDYYEGATALDNLLWKYLKSFEESNLFQKSIVILMSDHGHRYNTLRRASTGYFEER
MPMMFIYLPPWFRRKYPHLASNLGKNQNRLSSNYDVYMTLQHLLQLDSKSVDEFPDNLRA
RQCKSCQSLFFELPFNRTCQMAGIEEKWCCCQPTETITNSPHVSTIAEAIVQRMNEHLIS
HNLSDLCHNFTLDYVEKADRKTILSNGLRPADKNEQVYIIVFETVPKNPIFEATVRWNSR
TQRLLHFDVEELSRLTSYKNDANCINRKNAKKYCICKDSLSRPS
>38B.8
MANKLFQLYKKCALQLRCRNFTIIVYGFKACTILSLGLWSLLCQLSIPAQSSLDGVAQSL
TWIPDRNEGYPELELVLWPVLQQRLSLGQLRFHVEVGEKHQHRVGGYKNEYVPEAVQVWK
IDRGPGLAEDPVIDPAEHRNSPDGRRSDAQAVDPLVTNSV
>38B.9=purple
MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDR
RTGMVLNITELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKP
ELLYEVKIHETPKNIISYRGPYPLNGIYNPINKRIAHDSCTNISSDSD
>38B.10=KLP38B=Mothra=nebbish
MSNKSTPVRQRIQQFQTRGVHKSTPASEMRKKVLMTRAEDREHRDRPEQLLNTAFSGSTP
QPKPKPTALNACYTPSSLYRNANSTPGRAKTPGTGKSSCSRTKERDSLMESCLSVSEESN
MIVAVRVRPLNALECTRGQVTNVVQVHGNSNELTVQAGSSADASAGVTHFFSYDQVYYSC
DPERKNFACQAKVFEGTARPLIDTAFEGYNACLFAYGQTGSGKSYSMMGIEALDDAALDG
GPPHDEAGIIPRFCHELFRRIEAVKSQQQLQVEVEVSYFEIYNEKIHDLLSVQHAAAATG
ESTPIQQQQQQQRPALKVREHPIFGPYVVDLSAHSVDSYSALRNWLAVGNSQRATASTAM
NDKSSRSHSIFNIVLNLTDLSSDDGLSSDTDSSTASSLRQTRRSKISLVDLAGSERISVS
GSNGERIREGVSINKSLLTLGKVIAALADSRKAIANGPLGSGTPSTFVPYRESVLTWLLR
VSVTK
>38B.11
MLASTAEVISRVANQCAPSESFTRDLQQNTSNFGERFAAQEEERRKTSASHLHAKVHQKA
LLKKQNKVILKARFIGRPSQSRDKVKRPRTTRAKREKERKTHTHITNTIHIPLIGTAVRK
NSNETPHSTDMDVWGFCVSDTTMAYGGSMRSGYYRDYEEFPYGTLESTTSSHAVKDCYSR
VQEKCKQIKSEKQMRKDCPFCKEHKKRPLINYMRKREQRKHHDSICEDEEDMHEHEHELE
HTHNHSQSTVLAAPQSCKMDWATTIWCVSSLRWLRESPTDLRRHSKKYLSSPFMAKAAYG
NKSCEPFYGPYYRNEKQSGHWTLNNTQWNGFREKRQVFGLSIKSLSLVGAM
>38B.12=KLP38B=Mothra=nebbish
MHHRAFNITDVVPSFQENLGGNSKTVMLATISPASIHADETLATLRYACKARSIVNRVKV
NESPHDKIIRDLRAEVDRLKSLRNEYERQRRLSGNSNNPVPRKIIIETSVDETEVEALRQ
QLAERERELSRAQKSWMEKLKEAEDQRKSELRVLKRRGLALELTAEQKQACLVNLTADPI
LSGTLFYLLPQGLVRIGRGRLPGGSSSSQPDIVLDGPLVALQHCSIEHERGGKLYVIPGS
EDFETYVNGELLKDRRQLFHGDRLVIGGSHYFRISNPFCSQRGKADHPVDFQLAHQEILQ
KQEQQLRSELEAEKRAALTKIEQERAQHARDFEERLQCLELEQFKYKCNSEMLETERQAL
ALAQQQEHTPLRHEDAVSTPAQKSTILEDIQRIMLNPSEESLHKTQLMVKEATQRCRQLD
LPLEFRQTQTPDEFGLLRTVILILDKQRGLKAEWPTARLGVWLDLVRDNAEQQEKLNATT
IFQSVEVDWEPLDADLNETLSDTHNSSRIALNLSAMKDVLLNKPLKRLLNASSSKSNTPR
QTSTPSPGSQLVHFTKRLLTYDPEEIPESQSSFTTLVQQELQIMQRSAQRLRRHCEAALL
ERENHQDNGVLAVSLQEALARMDTVLNGMHTSLARAEATACVTSPTKTQKAVRFLID
>38B.13
MSKDHWMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFV
RRWSKTQSSGTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAMEIFEPLLEIRQFVDTHPE
EVVILDLQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIY
RRCPIPLPLRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRYI
AFRLFFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVD
LNTKLLEQLAGDKELESTEGVEEEEAQG
>38B.14
MSRKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVR
EQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPL
VIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDP
GAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGARE
GEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTC
DSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGR
SMAAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIK
FVLQNGRLRGAMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD
>38B.15
MASNSMPEENFEGGDFNFDDDAEDDQFVATNSGRKRLFSKELRCMMFGFGDDKNPYTETV
DLLEDLVIEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKAR
KAFDEIKYVGEYCKSSTFPKNYM
>38B.16
MEVFTFEKSYLERLKEAEAVLSWEGAVMPASQVRSEWKSYVELKIEPAGWQAIWKIPRVI
CEDLKLRYPTIVYGYVEQVIFDELKAVFVVTAVQDSDVHLPESNEVSLVELWPTVQQENA
ALNVDTTAECIDRLRFFYTHVWMPWDKDYDDDRDWVQQHLQARIQLVCDLSKNRLPRPLA
LHMRTLLAEAKYIQQRLDYLELDLSDAESDDEAVELNDSVAEPARKQSKAGSANGCLNVS
SLPVTDLMCLHLRMAIIRSEFEILENPEMRRAYSELQSNSLKRLRCSSGRTRQSEDLLVE
RNSISHVVTLPGKLQQQLELLKLAQTLVKPESKVQLSNTLQDVLSICQSNDDILLSPGEH
TIKFLEHLNDNGSLRGLTQPEAILSPAADLSLLPVVCSSDEDSTLLVIDGDYTLSELVLD
CRHVRRGILLRNGTLTMRGCRLLGDGSSSTQEGIVCMPGASVELKSCLIENFAVGVSMRP
KSSAELGSVQFKTCKTGLELLEKSASVNLQGSKCSFENCALGILADGFVLGEQRTEKVLV
LNKFSELQRYNEDNLLGNCSFYNCKKNVRVFNESGQLLAQRSHQQLLEDELGGENKENIQ
LV
>38B.17
MLPIARGIYIGLVNITRNSRGALHTASALRCKAETSTEENNAAATEGEGEDNASGSAPDP
KDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYSEYYGQEQKQKA
>38B.18
MAETKPQMASQTNGKGRHTRWHPYTRDFGGMNENGCAVRFGFPVDVLELNRHITGPVLVS
YEAPGFGNISGNEYMGTRVSTGWGFGAAGGNDINERRNMLGSLTRGHRLELRDGNQILWP
DIEFSHCIEFNQSGTVIKASQLFSPLDSCSKLLHPQTMAAKSDMDILANSMYEDDPNGNL
APATTKDKESVKPEELKVTPAGTKATSPPNSATLVSTSPRWGPQNKGAQELALLYSPGKR
AQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITADFASGLVHWAADTWGS
VDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVGIPILGYLAHYFYIRTPSEIQ
QHFGWIAYVFLCSIFVAMTNQQIDSNGYNMYAMYSIRFWSTFELIIEHFTGLKPRDDDLK
WAKKLT
>38B.19
MPSLNHRPMLTTDGNNNGQDGSHVRKYDGEGDESNDSDDGNRLQDPMQTEQDITIWNANG
LINNKPEDELYCKTNQADILSIFQTKERQPGKPEANLGFYRAGNPLQNTRKSIFAQSVAS
TGRCRSDPQFGFRRCHGTPEQCHRLVKRILETFERKQYCCAIMLDIKPAFDKVWHPGLHF
KIKMNLPSSHFAFLKSFTEVDINRPECQKWMVQVYSKCRDLFKTNTLPHWGLDNAPVVYK
ADVEAMTVLDCHRLKRALGKEVSEEDEEGDELDDLDDLDEGEEGLDPGRLVGLLLALCAI
ALLFVLLCRMKRRNIKLKEVELPKPEPQEAPSVLPQKKKLNRAANCKSWMRRSCRPFFLH
NESQLRQYQARAEMEVAVHEERTRQKIAMWTKARERDAQKKRDKLQRNVNKATKT
>38B.20
MAAILMIHKPGKPELSTKSYRPISLLSSPSKVWKRLIANRLGDIINECRVLPDHQLGFRQ
GHSTVEQAFDDKEYCNAVFIDMQQAFDSVWHDGLLSKIKRLFPAPYYGVLRSYLEDRKFM
VRARNSYSTPCVMGARVPQGSVLGQLLYSVFTADLPCPNAYHMADPRKALLATYADDIAL
LYSSNWCNEAARGIQEYLTTLAAWCKRWNLNVNPQKSTNPCFTLKTLSPATAPIELEGVI
LDQPLQAKYLGITLDKRLTFGLEAKPKQSSTSSRSNSTTETAEAAADKGQREIHSSSRRT
PATTSKPSSTSPIMMPLRILVWNADGVSTKLPEVECFVRRHEIDVLLLNETHCKRTETPK
LFGFVAYTANDPSGGNAKGGAAILIKSSLAHFPLTPIATDKEQPKRYCTSEPRPKLGGGL
ASNRRLATRSISRQPAADRIPITKEILLLIARRGAYVLERLANTGVESEATHSLWKATRA
IKRRCTRKAPLEDSNGTWCRTDLGQAEVFAAHLAERFQPFKLASLQQVEETQDLLNQALQ
MDLPITPFEPCEVAEVIVRQSSNKAPGHDVICNATLKALPSQAILYITLVFNAIVRLQYF
PYQWKLINKPGKPEREPASYRPISLLPSILKVFERLIAVRIMEAQGITPEHQFGFRAGHC
TVEQLHRVVEQILTAYDNKEYCNSLFLDIREAFDRVWHIGLQVKIKQTLPAPYFGLLKSY
LEGRRFAVRFHSAISTEHNVAAGVPQGSLLGPLLHCLYSHDMPQPDVSLYEKSMLATFAD
DVCVTYRSRYEHDAADGIQDFADRFSEWARRWNIGINSSKFNNVCYTLKRTATARLHRGS
PSTTAERSKFKIPPPEGVNQFRKAPTVGASGCSFIMDWQAVPIATSIKRKKKEKKNSSSS
DSYDTLEPVKVKRKNLVKHSHPIDGPTTPTHHQAALADNSFAILSSDDDDDEMFDDLPAK
TPLQEKEMEKPKAIKPPPIFIPDVTNIKALVNSIAGVLGKDVEFHLIRQATTTFA
>38B.21
MNQGKYLDVLNNHAFPSGDKLIGESFILQQDNAPCHKAKLITKFLKDVGVNTLDWPPQTT
SEIAVAIAEIVVVVAPEAILHQEICAVDYCLLVVEVIVASADGRLMVHPNRLANILVNPI
SLRRLKRVHPSDLPTRRIREGGVGGFIRRFHGTPEQCHRLVARILDAFENNRYCSAVFLD
VKQAFDRVWHPGLLYKLKSHLPSSHYALLKSYTEGREFQVRCGSSTSTTRPIRAGVPQGS
VLGPILYTLFTADLHIIPSRYLTAATYADDTALIATATNPQRASAIIQRQLDALDPWLKR
WNIVINADKKNSDSMKLPIKPRG
>38B.22
MLIVGVEPRILNLNDIKIVARDAFGIVNFVFRNMKIDFDIPDKWLLLYLCQRQDFTKFLI
DVTEIEDVVLDTAFSAGKFTSSDRCRLRISPAPSTIAIHQWRLPCATPFGCARNAPEQEW
RFTFHPSVKQRKSYFSTFKKLGRCIQWKASKSAPFRRTLFITEKVNKTRILPIDHIVTIV
HIRVLPLPSVISGKETVPRLGNIAKEGSAIFIKANIRHSQNKSTMRTDLQVTSLDVPTSG
SIIKIASLYLPPNKPWTKNDFDQLLITLGPKCIAGGDYNAKLQWWANLRTCSRGKRLQEA
IVTSSSEVIATDLYENSRIDCFLLQECRCVRAYLCEHDIHHSPAASGFSAEEGANLHTHT
RCTQAADDQVMSLPQYIAIAGYSGA
>38B.23
CCQLYYHAATTIIVYSRPSCSSSTLLSLSSFAFRKNRTKMITKMTMHDKESKREI
>38C.1
MFKHYPKNREATAKANDCHLATLGIERSGSRGKKTRRKGIQSICHNFRQWLIKTKNKKQN
QHNRGKSTLSQDLLKSNGTHSSVTVEDDEHGDVDAAASVLRGTAKRCIPGGAVESYDRMA
THSHTHTRILAPFLQGVHPFQSGLFLAAAVSIKIQVRCSTVAVIVRFASLINGIQAHSSG
KDMQNRSKDSRGQRSRSPLTDKRDTQGDTKICEKAKAKPHSKRHDGRL
>38C.2
MVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIR
DQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQK
SKILLKTVSRELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDN
PVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNGGSLFVEPENDYNDGQEENMENDY
EFETTVFTLPTYDPNDVLPTLPDNPDLNFNTIVKD
>38C.3
MTPNAIYPYKLQPEKRGNAAPAAAAFAVKFQRVSVCRLNVCRILLEKGGQTTNKVVTKSL
TVWHLHRNAIFGQKTHTTETGEAVAKVLPPSCAASLRRQAHIIGARVNVLLRNVQFRPHL
VVPTRTPPKEKTRRIHCVRCWDYRSGVSSVSAVKSEIPGHAETEEAAECMETEMETQHLG
KYFT
>38C.4
MGKTKRVVGLTLKEKLQIIELVTNKVDKKEICAKFKCDRSTVNRILQKTNEIHEAVVASG
LKRKRQRKGAHDLVEEALYIWFGQQESKNVILDRHVILAKAKEFCQKFNDAFEPDASWLW
RWRKRHNIKYGKIHGETATNDSVSANEYKNDILPGLLKGYNPEDIFNADETALFYKAMPN
ATFFTCGKQLNGQKSQRVRLTLLFICNATGTYKKTFVIGRSKSPRCFKNANVPIPYYANK
KAWMTKDLWRKIMTGFDEEMKKQNRKILLFIDNATSHTTVKDFENIKLCFMPPNTTALLQ
PLDQGIIHSFKLEYRRILVKQQLIAVNCGKSTVEFLKSLSLLDALYFVNQGWKNVKMLTI
QNCFKKAGFKFSFENEDTIAEKDKQCVEVDIVSNINWNEYANVDADEACHGQLDDDEIVR
SLVQDAKTSDNEESHSDEDVDDTERPTFKDGFAAIKALKKTKEPLGIFFANLEPASNNKE
VFQIRILCRSVVTIEPPLEFNNVPQCFRCQGFGHTQRYCFLEHRCVKCGGHHDTRTCAKK
EDEKACCLHYQADHPASFRGHRRKDDGENVLANYAASCFHPQRKSMQSLKIVLWNANGLQ
RSRDEVKHLLKTDAIDVLLQTVTSTQNTPGGVHSINPKGRTLHRFLQSRRLDCHSSGEPT
HWLTNPALLPDLLDFAISKGIGQARLTCSKELKDSYVPDGKTPSTDSLRSWNLGILSKIL
ERVFLRRVLPVLYEAGLIPDHQFGFRRSHGTPEQCHRLVEQILEALERKQYCCAVMLDVK
QAFDKVYKIKTHLTGSHFAFLKSFTEGREIQVRCGTATSTPRPIRAGVPQGSVLGPILYT
LYTADLPITPSRSLTVATYADDTAFLASASDPQEPSAIIQSQLDALDPWLKRWNIAVNAD
KSSQTTFSLRRGDCPPVMLNGETILTSSSPKYLGLTLDRRLT
>38C.5
MGKTKRVVGLTLKEKLQIIELVTNKVDKKEICAKFKCDRSTVNRILQKTNEIHEAVVASG
LKRKRQRKGAHDLVEEALYIWFGQQESKNVILDRHVILAKAKEFCQKFNDAFEPDASWLW
RFNSQFNCLLGMDWAHNLL
>38C.6
MGKTKRVVGLTLKEKLQIIELVTNKVDKKEICAKFKCDRSTVNRILQKTNEIHEAVVASG
LKRKRQRKGAHDLVEEALYIWFGQQESKNVILDRHVILAKAKEFCQKFNDAFEPDASWLW
RFNSQFNCLLGMDWAHNLL
>38C.7
MDKAKRNIKPFDGEKYAIWKFRIRALLAEQDVLKVVDGLMPNEVDDSWKKAERCAKSTII
EYLSDSFLNFATSDITARQILENLDAVYERKSLASQLALRKRLLSLKLSSEMSLLSHFHI
FDELISELLAAGAKIEEMDKISHLLITLPSCYDGIITAIETLSEENLTLAFVKNRLLDQE
IKIKNDHNDTSKKVMNAIVHNNNNTYKNNLFKNRVTKPKKIFKGNSKYKVKCHHCGREGH
IKKDCFHYKRILNNKNKENEKQVQTATSHGIAFMVKEVNNTSVMDNCGFVLDSGASDHLI
NDESLYTDSVEVVPPLKIAVAKQGEFIYATKRGIVRLRNDHEITLEDVLFCKEAAGNLMS
VKRLQEAGMSIEFDKSGVTISKNGLMVVKNSGMLNNVPVINFQAYSINAKHKNNFRLWHE
RFGHISDGKLLEIKRKNMFSDQSLLNNLELSCEICEPCLNGKQARLPFKQLKDKTHIKRP
LFVVHSDVCGPITPVTLDDKNYFVIFVDQFTHYCVTYLIKYKSDVFSMFQDFVAKSEAHF
NLKVVYLYIDNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMV
SGAKLDKSFWGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYLKHLRVFGATVYVH
IKNKQGKFDDKSFKSIFVGYEPNGFKLWDAVNEKFIVARDVVVDETNMVNSRAVKFETVF
LKDKFPNESKECDNIQFLKDSKESENKNFPNDSRKIIQTEFPNESKECDNIQFLKDSKES
ENKNFPNDSRKIIQTEFPNESKECDNIQFLKDSKESNKYFLNESKKRKRDDHLNESKGSG
NPNESRESETAEHLKEIGIDNPTKNDGIEIINRRSERLKTKPQISYNEEDNSLNKVVLNA
HTIFNDVPNSFDEIQYRDDKSSWEEAINTELNAHKINNTWTITKRPENKNIVDSRWVFSV
KYNELGNPIRYKARLVARGFTQKYQIDYEETFAPVARISSFRFILSLAIQYNLKVHQMDV
KTAFLNGTLKEEIYMRLPQGISCNSDNVCKLNKAIYGLKQAARCWFEVFEQALKEFETQI
GRHTSRYSDRLLSHSSLLARLLIPARPLRRLKRQGFAKAIGQQ
>38C.8
MTATVHKILVHSKDILEQTVFPVGYFGEEAAESRNTIYQLDRHHHARKHNRICSFADLVQ
RAMDTSDSIISSINLKGRIRKQNRLPLPPEVIQMLAYEFEPDNDSLDSADCDEEVLYNIK
MEN
>38C.9
MSWTAYRDIKVERNSDGEFDLEPVGFCPNTTNSTAAMDAAQLQAIIAGAVNQALTEQENR
LKRDFQAQLDEVKQQMQHLRVEAPQVETYQKITAGPEVRCDIKLDIVKTMPDFSGEQDDY
VSWRQSAVDAYEIFKRYNGSEAHYQAVSIIRNKIRGPARGLLVAHNTVLNFDAIIARLDC
TYADKTSLRVLRQGLDTVRQGELSLMQYYDDVEKRLTLITNKIVMTHEPDSAILFNNEVR
EDALHAFIAGLRKPLRAIVLPAQPKDLPSALALARESEATIERTNFAATYAKALEDKAIT
YEHRKDRNHSREPHGRYSRAEDSQGKNPHFYKKQGRQNNSAQNNNSYRNQSPEPMELGST
VTQHRQPTSFGSGQPASVKAEGARGQKRFGSARMTGQRRQRVQNTIQQADDKNDSEYEGA
AAAAVTEIDDEERSRLPFIERQFHGRKLRILIDTGAAKNYIKPVKELKNVVPVNSPFTVS
SIHGSNTVKQKCLVNIFGKTADFFLLDTLTLFDGIIGFDFLAQVGAKLDTEKGTINYGSV
VEELQHHSCDEVNFTNVNDATVPESVKTEFTAMIANRSKAFSASNEALPFNTSVVATIRT
SDDKPVYSKLYPHPMGVSEFVKREIADLLQKGIIRTSRSPYNNPTWVVDKKGHDEQGNKN
KRLVIDFRKLNEKTIADKYPMPNIPMILANLGKAKYFTTLDLKSGYHQIYLAEHDREKTS
FSVNGGKYEFCRLPFGLKNAGSIFQRAIDDILREQIGKSCYVYVDDVIIFSENENDHVKH
IDWVLKSLCDANMKVSNEKTHFFKQSVEYLGFIVTNGGAKTDPEKVKAIKEYPEPTNLYE
LRSFLGLASYYRCFVKDFAAIARPLTSLMKGENGSISKHMSRKTPIEFGDLQRDAFERLR
NVLASEDVILRYPDFRKPFDLTTDASANGIGAVLSQDKRPITMISRTLKESESHYATNER
ELLAIVWALGKLQHYLYGTRDINIYTDHQPLTFAVSDRNPNPKIKRWKAYIDDHNAKIHY
KPGKDNHVADALSRQNINALQSEPPSDAATIHSELSLTYTVEATDQPVNCFRNQIVLEEA
RFRLKRSLVLFRSKTRHLINFADKSTILEMLKEVVNPDVVNAIHCDLPTLASFQHDLIVH
FPATQFRYCKNIVIDVTNRNEQLEIVTTEHNRAHRAAQENTKQILRDYYFPKMSSLAKEV
VANCKICTKAKYDRHPKKQELGETPIPSYTGEMLHIDIFSTNKKQFLTCIDKFSKFAIVQ
PVLSRTIVDVTGPLLQLVNLFPKIKTIYCDNEAAFNSETITSLLKNSYHIDIVNAAPLHS
SSNGQVERFHSTLSEIARCLKLDKKISDTTELILRATIEYNKTLHSVTQEKPVEILHSGP
DDRCLGIKDKLVKAQKNNIERCNPARQNRVFEVGDEVFVKNNRRFALVTLIILAVANARI
TDFSHAKYIPVVDGDVLVFEHRNCLRHSSNLSDYIYMVDETKKLSASFPQSHMRKLLDVD
TDHLVNLLSVLKIHHRIARSLDFLGTALKVVAGTPDASDFLKIKMTEAQLVDSNSRQINI
NSETQIQINKLTDTVNRIIKARNNDLVDTPHLVKVKCKKVLVYPVSHYQTILRLDEDTLA
ECEEDTFSVTECVETTHDTFCERSRRDTCARSLHAGNTAQCHTQSNHLRAVMPIDDGIVI
INEATARVSTDGGPEVLVKGTHLITFEQSATINGTEFVNLRKAINKQPGVARSPLLNIVG
HDPELSMPLLHRMNNDNLRFIQGFKDEVDAAGSPKLWFVAGVVLNVGLIGSLILFLALRK
RRASAEIQQTIDKLNITEDGHNLRGGKWLEALGCQTSGTKAELIVRLQAISPETRGDSPP
NNGSAAEELEELDGAAAWPKQREPQGGDTRTIPFDEQSLQSEPPENLDLDQLSLVDAERA
TLKKLRDEIEANMAVLQRIQADIDDANKSKSAHVRQINDVIENNSNGNHGNVNICANSTD
ANVNSTKVTIDYGTYQCWKRNRW
>38C.10
MSWTAYRDIKVERNSDGEFDLEPVGFCPNTTNSTAAMDAAQLQAIIAGAVNQALTEQENR
LKRDFQAQLDEVKQQMQHLRVEAPQVETYQKITAGPEVRCDIKLDIVKTMPDFSGEQDDY
VSWRQSAVDAYEIFKRYNGSEAHYQAVSIIRNKIRGPARGLLVAHNTVLNFDAIIARLDC
TYADKTSLRVLRQGLDTVRQGELSLMQYYDDVEKRLTLITNKIVMTHEPDSAILFNNEVR
EDALHAFIAGLRKPLRAIVLPAQPKDLPSALALARESEATIERTNFAATYAKALEDKAIT
YEHRKDRNHSREPHGRYSRAEDSQGKNPHFYKKQGRQNNSAQNNNSYRNQSPEPMELGST
VTQHRQPTSFGSGQPASVKAEGARGQKRFGSARMTGQRRQRVQNTIQQADDKNDSEYEGA
AAAAVTEIDDEERSRLPFIERQFHGRKLRILIDTGAAKNYIKPVKELKNVVPVNSPFTVS
SIHGSNTVKQKCLVNIFGKTADFFLLDTLTLFDGIIGFDFLAQVGAKLDTEKGTINYGSV
VEELQHHSCDEVNFTNVNDATVPESVKTEFTAMIANRSKAFSASNEALPFNTSVVATIRT
SDDKPVYSKLYPHPMGVSEFVKREIADLLQKGIIRTSRSPYNNPTWVVDKKGHDEQGNKN
KRLVIDFRKLNEKTIADKYPMPNIPMILANLGKAKYFTTLDLKSGYHQIYLAEHDREKTS
FSVNGGKYEFCRLPFGLKNAGSIFQRAIDDILREQIGKSCYVYVDDVIIFSENENDHVKH
IDWVLKSLCDANMKVSNEKTHFFKQSVEYLGFIVTNGGAKTDPEKVKAIKEYPEPTNLYE
LRSFLGLASYYRCFVKDFAAIARPLTSLMKGENGSISKHMSRKTPIEFGDLQRDAFERLR
NVLASEDVILRYPDFRKPFDLTTDASANGIGAVLSQDKRPITMISRTLKESESHYATNER
ELLAIVWALGKLQHYLYGTRDINIYTDHQPLTFAVSDRNPNPKIKRWKAYIDDHNAKIHY
KPGKDNHVADALSRQNINALQSEPPSDAATIHSELSLTYTVEATDQPVNCFRNQIVLEEA
RFRLKRSLVLFRSKTRHLINFADKSTILEMLKEVVNPDVVNAIHCDLPTLASFQHDLIVH
FPATQFRYCKNIVIDVTNRNEQLEIVTTEHNRAHRAAQENTKQILRDYYFPKMSSLAKEV
VANCKICTKAKYDRHPKKQELGETPIPSYTGEMLHIDIFSTNKKQFLTCIDKFSKFAIVQ
PVLSRTIVDVTGPLLQLVNLFPKIKTIYCDNEAAFNSETITSLLKNSYHIDIVNAAPLHS
SSNGQVERFHSTLSEIARCLKLDKKISDTTELILRATIEYNKTLHSVTQEKPVEILHSGP
DDRCLGIKDKLVKAQKNNIERCNPARQNRVFEVGDEVFVKNNRRFALVTLIILAVANARI
TDFSHAKYIPVVDGDVLVFEHRNCLRHSSNLSDYIYMVDETKKLSASFPQSHMRKLLDVD
TDHLVNLLSVLKIHHRIARSLDFLGTALKVVAGTPDASDFLKIKMTEAQLVDSNSRQINI
NSETQIQINKLTDTVNRIIKARNNDLVDTPHLVKVKCKKVLVYPVSHYQTILRLDEDTLA
ECEEDTFSVTECVETTHDTFCERSRRDTCARSLHAGNTAQCHTQSNHLRAVMPIDDGIVI
INEATARVSTDGGPEVLVKGTHLITFEQSATINGTEFVNLRKAINKQPGVARSPLLNIVG
HDPELSMPLLHRMNNDNLRFIQGFKDEVDAAGSPKLWFVAGVVLNVGLIGSLILFLALRK
RRASAEIQQTIDKLNITEDGHNLRGGVVNN
>38C.11
MIVCFFVCFVGLMSVRPTTFVTPLGQFEFLRMPMGLKTASAVFQRFVNKIFEDLIRDNKV
IAYMDDIMIASKNSEEHLETLKEVFIRLAQNKLELRMDKCEFLQTNIKYLGFIINGEGIR
ADDKGIDAIEHFPVPDKIQAVQSFLGLCSYFRRFIKDFSTLAKPLYDLLRKDEKFKFGEK
EMSCFSTLKEKLVQAPVLAIYNFKDEIELHCDASALGFGAVLCKKKEDGKLHPIFYFSKR
TTVAEAKYHSFELETMAIIHALRRFTIYLYGKRFKIITDCNSFTLTLNKIELNPRIARWA
LELQNYDYELIHREGKRMQHVDALSRCTNILIVESNTFEDNLVICQGKDQKVQEIKKLLE
KNEHNLFEMRNGIIYRKCNNGRLLFYVPTDMEDHILYKYHNEIGHIGRDKMLDVISKSYW
FPNAKDKCLSHIENCLKCVAFSPKTGKEGFLHCIPKGSKPFVLIHIDHYGTVDSGRSKKH
IFVVIDGFTKFVRLYATKTTNTKEVITALKKYFRAYN
>38C.12
MHEDCRPFSAVTGAGFKNLVKFFLKIGAVYGDQIDVDDLLPDPTTLSRKAKSDAEEKRSL
ISSGIKTAVDSGGASATVNMWTDEHVQRNFLAITFHYGKEFKLCDMILGLKSINFQNSTA
KNILMKIKGLFSEFNVENIDNVKFVTDRGANIKKAQAV
>38C.13
MIGARDVEYRIDSGARTTGCLSACADLYCAFVIEIGTDKKEALNAVSKWTVGACPPFSAV
TGSGFKSMVKFFIKIGSTYGELVDIDELIPNPTSIA
>38C.14
MRAYRVVIKGLHHTADRAEIQEELEKLTHKQQQGGIPDEDTVQVTIEPPLEFNNVPQCFR
CQGFGHTQRYCFLEHRCVKCGGHHDTRTCAKKEDEKACCLHYKADHLASFRGHSITETHL
QEFFETFGPRFIAAGDFNAKHSWWSPLHQPQRQNAPQIPAEQKTGLPLLWHRASQTNLLQ
GNSKTSYVTYGKTPSTDSLRSWNLVTRNTICGMSRVISGGLQRRRHRVLPEIVQKSFSSS
NLENLKPILPHIDRYTVRPSSWMTSRRSTECGLLYKLKSNLPSSHYAILKSYTEGREFQV
RCGSSTSTTRPIRAGEPQGSVLGPILYTLFSTDLPSIPSRYPTAATYEDDTAFLATATNP
QRASAIIQRQLDPWLKR
>38C.15
MTATVHKILVHSKDILEQTVFPVGYFGEEAAESRNTIYQLDRHHHARKHNRICSFADLVQ
RAMDTSDSIISSINLKGRIRKQNRLPLPPEVIQMLAYEFEPDNDSLDSADCDEEVLYNIK
MEN
>38C.16
MQSLKIVIWNANGLQRSRAEVEHLLKTDAIDVLLVSETHFCPRSHFSISGYDVIPANHPS
GRARGGAAMLIRSGIQYTELPAFQEEWAQCALARISSLHGDITVGAVYFPPRHSITETHL
QDFFESFGPRFIAAGDFNAKHSWWGSRSINPKGRTLHRFLQSRRLDCHSSGEPTHWPSNP
SLLPDLLDFAISKGIGQDRLTCSNYNKLISDHSAIKMLLNIPVLKKELPRRLTGKHTDAS
KFTLWMLSSLHPDPPLSTPSNIDAAIKTLTDEMYNAAEFANPPPSTSPRTPGRDLHLWSP
EIAAFVAEKRRLRRIWFFSRNPRDKAALNRAIKELKDKLCTLRQDSFDRFLEELEPGDPQ
HNLWQVTRHIRRPAKKASPVRKADGSWCRSEAERAEAFADLQNAFTPFDRCTGEERAATT
RFLESPCPPSLPIEPVTPEEVAQEIASLKASKSPGLDRIDATSLKMLPPPCSQLLANIYN
RCFSLGYFPRSWKRAEVILILKPGKPEANLASYRPISLLTILSKILERVFLRRVMPVLDE
AGLIPDHQFGFRRSHGTPEQCHRLVARILDAFENKRYCSAVFLDVKQAFDRVWHPGLLYK
LKSHLPSSHYALLKSYTEGREFQVRCGSSTSTTRPIRAGVPQGSVLGPILYTLFTADLPI
IPSRYLTAATYADDTAFLATATNPQLASAIIQRQLDALDPWLKRWNIMINADKSSHTTFS
LRRGECPPVSLDGDTIPTSSTPKYLGLTLDRRLTWGPHINNKRIQANIRLKQLHWLIGKK
SKLREKLKILVYKTILKPIWTYGIQLWGTACTSHRRKIQRFQNRCLRIVSNAHPYHENSA
IHEELGIPWVDDEIYRHSVRYASRLENHHNHLAVNLLDHSQSLRRLQRTHPLDLTQHT
>38C.17
MLLKEKRAQIQDGMFAKNCLLRAYITETGTTFSLRSGECPPVTLDGDTITTTSTPNYLGL
TLDRRLTWGPHINRKRIQANIRLKQLHWLIGKKSKRPSLPRNSAIHEELGIPWVDDEIYR
HSASNQESKKTEEIDKKIVNFELFIKKKLPECNRQLDRFISKHTKWMASKITIVVSDFEN
SNIPQQMGRRNLSYQNAGERLKRKLASNLASESDHDTSLLIHAATVSARKECKRDVAFVL
KETLKTPEFPSGCKFNAKNQLLFHQMKL
>38C.18
MPDDKYVVRHSATSATTEDSRVINGWPFKSSFVVLRRQLNKLLRVISLTFVAGISFIVIL
TRAFAQIEWNNLPPAINSFAIKVNLHELKGSEL
>38C.19
MGKGGGWVWLWRMPKECRERVAGCCLNYAKFAPTPAEMGTRTNNIIVDVPPFCTGNFIIS
RPSPSKATATFTPSLSSFAAVAVTLPAIFGYF
>38C.20
MEGRWRTGRQASAAASPKVWRHEHAKGKDTGRQGHPSAAGQHLQQVVYGFSPSPVSYGST
SATFLPIFGLVKLNYYAKSTMSICATKKVKATARRGAHWSSTAGELDADAEWGLEVPHFS
RTFSELLLRVSMRNDGSGSGFGFGFWGKGPNFVSEKLRRSLLQKFITVQMLPVLVNRAAE
RGSEGTTGRKDERKGAGNAFKSSLSFELFNYKVRKMFAYFSAVCDTDEEQFSVFSFQQLA
VFRGPVFPHLRLLAVIALFASCHTAQLVHVALHFARFLGLGFGRVRGGGALDWDIVSYSE
KRLSGSGRVKLVTKLLAKTSSTVRGRPKCKSRSGRTAAARSA
>38C.21
MTTPATTDKNNDNNTSSNTNNNSSNKKSNESRQQQRDMARTTTMAAGKASGKMREENIWH
TLRRAKSDKMWRNESKKSESDAEASPEVEFYAAKSAVWHFERPPSRKSRSFEHQHRLKHS
>38C.22
MNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGS
LIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAI
IKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKD
CAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGV
YADVASLRSWIVDTTDSL
>38C.23
MPETAAICSANRAVTKNREQNKALSYHTDAKANFPFTASMRPLFLLRVQLMCTDLFRYRL
LECQRRQVQDPEIGRDGELVVQSQGLS
>38C.24
MPNIVALKLSASYPLMPGHKDEGNILALDQLALQQQISANFIFHAISNYKKTPSERKTLV
FIAKKWLHIQMLWREFRLRDKQIRRLGHKDARVLEHGYFQQELFELVHEKYMVVRGFLSR
DKRNLLAAIPFPFPNANSNPNPNPNPYPSNNNPNPMGNQSDWTLDAIYAQSQ
>38C.25
MQKSDYPRTFHTRPQGVWRSGPPSGVCKCAYGTWLMMGHCEERRGWDPSGWLRKWRGRWA
EWHHNANDICLKEWQPESGYSHFMVADFGSATFGGGSQCQCVRTGAYQAYRPIIPR
>38C.26
MRICGQEPPSVGGSSSVAGVGAWPGRCEHVFLPVECSWWPLIEMHVVGLAEERGSWIQTA
AEALTGSRKRLKVFSVSRWGKEQAYQTAMLPSGFRCPRAAAIAAGRAKVAAGAGTNEKGH
RVGVEFNFQKKKKTLKTSARPAAVAGRMEKSKINEARAQCNQWLKPEHNRVAATIKQHQK
HDQQLQQLVKQPGHFTQIEIGRKIALS
>38C.27
MDKAKRNIKPFDGEKYAIWKFRIRALLAEQDVLKVVDGLMPNEVDDSWKKAERCAKSTII
EYLSDSFLNFATSDITARQILENLDAVYERKSLASQLALRKRLLSLKLSSEMSLLSHFHI
FDELISELLAAGAKIEEMDKISHLLITLPSCYDGIITAIETLSEENLTLAFVKNRLLDQE
IKIKNDHNDTSKKVMNAIVHNNNNTYKNNLFKNRVTKPKKIFKGNSKYKVKCHHCGREGH
IKKDCFHYKRILNNKNKENEKQVQTATSHGIAFMVKEVNNTSVMDNCGFVLDSGASDHLI
NDESLYTDSVEVVPPLKIAVAKQGEFIYATKRGIVRLRNDHEITLEDVLFCKEAAGNLMS
VKRLQEAGMSIEFDKSGVTISKNGLMVVKNSGMLNNVPVINFQAYSINAKHKNNFRLWHE
RFGHISDGKLLEIKRKNMFSDQSLLNNLELSCEICEPCLNGKQARLPFKQLKDKTHIKRP
LFVVHSDVCGPITPVTLDDKNYFVIFVDQFTHYCVTYLIKYKSDVFSMFQDFVAKSEAHF
NLKVVYLYIDNGREYLSNEMRQFCVKKGISYHLTVPHTPQLNGVSERMIRTITEKARTMV
SGAKLDKSFWGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYLKHLRVFGATVYVH
IKNKQGKFDDKSFKSIFVGYEPNGFKLWDAVNEKFIVARDVVVDETNMVNSRAVKFETVF
LKDSKESENKNFPNDSRKIIQTEFLNESKECDNIQFLKDSKESENKNFPNDSRKIIQTEF
PNESKECDNIQFLKDSKESNKYFLNESKKRKRDDHLNESKGSGNPNESRESETAEHLKEI
GIDNPTKNDGIEIINRRSERLKTKPQISYNEEDNSLNKVVLNAHTIFNDVPNSFDEIQYR
DDKSSWEEAINTELNVHKINNTWTITKRPENKNIVDSRWVFSVKYNELGNPIRYKARLVA
RGFTQKYQIDYEETFAPVARISSFRFILSLVIQYNLKVHQMDVKTAFLNGTLKEEIYMRL
PQGISCNSDNVCKLNKAIYGLKQAARCWFEVFEQALKEYLTTAVNILSRYSSKNNSELWQ
NLKRVLRYLKGTIDMKLIFKKNLAFENKIIGYVDSDWAGSEIDRKSTTGYLFKMFDFNLI
CWNTKRQNSVAASSTEAEYMALFEAVREALWLKFLLTSINIKLENPIKIYEDNQGCISIA
NNPSCHKRAKHIDIKYHFAREQVQNNVICLEYIPTENQLADIFTKPLPAARFVELRDKLG
LLQDDQSNAE
>38C.28
MDDKIILNDFSLTTLKDWLRILGQNTEGTKTELIARLQDIPTAVRGDCPPDAPPGNDIFS
SLDFQNCEINTDHVSVNAMNRKESTETGSERETNMFELQQLRAELAEAKAMLNGTRSSLQ
FQEQQQPEQSKATVSSVIQTAQFTQAGATKENTTFHSPQRSNERAESQRFPVDALALAKE
TITDYDGKTCARAWITVVKNIARTFNIDDNHLRILLITKLKGNAQVWLHAHPARLIEPID
NLLDQLSLTFGEQSSKAEIRRKFESRKWKTEENFCSYYDEKMALSNGINIDDDELLDQMI
EGIPLQNFRTQARIQCFSTPSEMLRAFSNIRLPARREPPVQPTDYKDAIRCANCNSRGHK
ADICKKPKREPGSCYACGQLGHLVAQCPTRKSVSSNNYVRWFKINFFENAYKPIISECLI
DSGSPISIIKKSLINETMKLALVNTCYFGLNNCILKTHGQTTCYVLKGSIKIYFRLIIVC
DQSMRYNVILGRDFLTACNLNLDPYTLGMIALRKPMEINKIAMFTENDSPEKSLENEIVS
PKSLENEIVSSQSLENEIVSPKSLENEIVSPKSFKNATISPKSLENKIVNQQHKETGPIS
LRDEIVNQQKNVSKSKLSEDEIVNTSKEIVSFKLPKDKNVYEQLNHNFDKEVLRICHVTE
SELEYKIGENVSNRLQLEFDRLFRNFYINAKRPNEPTVRSEIQLCLKNPKPFSCSPRRLS
YTEKDRLQKLLDEYLENGFIRPSDSEYASPIVLVKKKTGDLRMCVDFRKLNKMTMKDNYP
LPLIDDLLDRMNEKTVFTKLDLKNGFFHVHVKKESIKYTSFVTPLGQYEWLRMPFGLKNA
PSVFQRFVNKIFADMIRENKVVVYMDDILLATENINEHLETLKEIFKRLVENKLELRIDK
CEFMQSSIKYLGFIINKDGIMPNDKGIEAIKNFPIPNNVHTVQSFLGLCSYFRRFIKDFS
RLAKPLHDILKKDKPFKFGSEEMICFNMLKDKLIQSPVLAIYNHKHETELHCDASSSGFG
AVLMQKKEDQKWHPVSFFSKRTTDIESKYHSFELETLAIVYSLRRFRVYLHWRTFKIVTD
CNSLILTLSKKELNPRIARWALEFQGYDFEIVHRAGSRMQHVDALSRCTNIMVIQTNSFE
DNLVICQGKDTKLKEIRQLLENTENKLYEMRNGIVYKKTNENRLLFYVPIEMEEQVLYKY
HNELGHVGRDKMIEAIMKNYWFPNLKQKCSTHISNCLKCISFSPKTGKTEGFLHNIPKGN
KPFEIIHIDHYGPVDLARPKKHILVIVDAFTKFVRLYATKTTNTKEVIQSLNDYFRAYSR
PKCIISDRGACFTSGDFDSFLKECYVKHIKIATGSPQANGQVERINRSLGPMISKLIEPD
QGLHWDLVLEKVEYTLNNTLHRSIKQYPSIMLFGLQQKGQIMDELKEKIEEIGETIEERD
LESIRNKGEASQKIAQAYNKEYVDKKRKRSGVFTKGDYVMVKNFDSTTGIAKKLIPKHKG
PYVISKVLKNDRFLLEDVDGFQISRNPYRGVWSML
>38C.29
MLGYRIQDTAPEGYWYAGADINMRRLLQRSAADKMASWLIAMASCRQSAVPWLPSLLEPR
PPIQAIRQRRSLSASDLFALSPCGRGLMYVCVRRFNGGRPQVGFKMYKDVPFS
>38C.30
MVASLVGFNLCGSHVARTQSHLQRLQHKYTVKLLRPKFRELARGIGSESVGMEGQIGNYN
CSKAAEVTNSLTLAFTPSPGCHAMDDCNVNGSEIEGLVGNAGRKSGLIDFKIESNQINLQ
APFVMEKYAKFQLGKNKLGKIDAAGLLCALLTLSVSLSISILPSALINLNFHRQMAGKSF
QLLSFPTVLLLPRFPAEGGLHFHLLRFKGLSFKARLKCRANI
>38C.31
MAEEDRICRTFSHWQPFKYVMALWVSWLDPLLLWVEEQTHHRKEDLAQNMRGSGWMWVEL
GGIGGNLRQWVVVRWGWWAKRPLVSKLKAGQVPVSNINDGFGSN.MSISLIRKHLNEMGTL
KLRSSMGRNYIPMAGPPRFPMSSAQRLIFGCGSLVVMMIIPFYCLFSLPRWSRMHLGLPP
EEDEQAEEPPPQEEKDKEKK
>38C.32
MCPLVPFCHHRPHSALKTCFIFVVMPRHSSGISGSHGAASLHFSWALQDQLFGGRNGDRG
SGNHSADTCRTCHTRFVALRQFSVSEAARRKLPRCSAKSETILTEIFIIIKRERRSGSQI
PVPIHRWFPIAMSLSSSNIAAHKEFALCPPTDSNSQIQLIANRLIHHIEPITYITPIVSA
HTLVTISDHPNPQTQTRKKASQTQIYGVVNTPAPLGTTDRFVPMKISFRLCANKN
>38C.33
MSTKQTFEHPAPVEQRDLPSIKEVIKVDPSAGPKPLTIQEYKARTAAREQPPKKKRGGRR
IKLLSARRLNIELLKTATNEEDRQRYKERLAAINQQLRGAKDAFDKSYKCINKTALIKTQ
TLIFHIKVLITQYNTLQNLIVTNKSKLTEEHKVQCFKVLSSFGKRLHNTSVRHSIIIEVP
TELTKIAEFDESQLRDLDESQPLEDLDIESDIESIEELKFNTVQPNTRNMANALEAQRAY
VKQVSATVPEFDGKKLHLNRFVTALKLTDLTKGDQETLAVEVIKTKIIGPLNYKVEHATT
IQAIITILQANVKGESPDVIKAKLINAQQRGKTASQYVTEIDSMRKQLEAAYIDGGLDAD
NADKFATKESISAMTKNCANEALKMILTAGTFSTFNDAMEKYLHCSTEITGNSNTVLFYN
GNNRRGNYNAYYRGRGRNNYNHNYNQNYNQGYNNNNRGRGGYRGHGNNRDGGIGQGTIQS
IGTVDLDIRIQDVLVPHEFHVVPENFPIPCDGIIGIDFIKKYNCVLEFQNNKDWFTIRPN
NFSRQISVPITHNLDSNTLLLPARCEVIRQVKLLTNEKTVVVPNQELQPGIIVASTIADS
KNALIRIINTNNKDAIIDSAKIKCESMKDYDIFTTPVEKENRTEEILKQLRFPKQFNNEL
TKLCTEFSDIFGLETEPISANNFYKQKLRLGEKTPVYIKNYRMADSQKPEIARQVKKLID
DGIVEPSMSEYNSPLLLVPKKPLPNSTEKRWRLAVDYRQINKKLLSDKFPLPRIEDILDQ
LGRAKYFSCLDLMSGFHQIELEKRYRDITSFSTANGSYRFTRLPYGLKVAPNSFQRMMTL
AFSGLEPSQAFLYMDDLVVIGCSEKHMLKNLTNVFELCRRHNLKLHPGKCSFFMKEVTYL
GHKCTDKGILPDDTKYEVIEKYPIPTDADSARRFVAFCNYYRRFIKNFSDHSRHLTRLCK
KNVQFEWTAECNDAFEYLKTELMKPTLLQYPDFGKEFCITTDASKQACGAVLTQDHNGQQ
LPVAYASRMFTQGESNKSTTEQELTAIHWAINHFRPYIYGKHFMVKSDHRPLSYLFSMKN
PSSKLTRMRLDLEEYDFTVEYLKGKDNHIADALSRITIKDLKTINREILKVTTRSKAKQE
NSCKDEAIVKIQEEKEQTIEKPKVYEVVNNNDTKKYVLIKIDKHKCLLKRGKTIVSRFDV
DDLYSNETFDLNQFFQRLISKAGMHKITKMRISPSEQMFQFVSLNEFKIKGNRVLEKVEL
AILQKVIIIDKNDEAQIKEILTKFHDDPIEGGHTGISRTQSKIKRFYYWPQMTKTISKYV
KTCLKCQQAKITTHTKTPLTLMPTPATAFDTVLIDTIGPLPKSEDGNEYAVTIICDLTKF
LVTIPTPNKSAKTVAKAIFELFVLKYGPMKTFITDQDMKINLKIIGSGEGSGASAIGGYV
RKWLLLSQPPTWRSVKQTDKTCQSVNPSDTDAFGHRESEGEGLALALALA
>38C.34
MTEHQAEEQADTPPTKVKATPTPTPSGKFKDAKEDAFLSTSPDSANGDAQHKLPADQLAM
SSSAHPQQAGQARPLILQAFHRCSSPEQCVTLHDILDSFKAPLSEDQAWALIHQFAGLYH
QVAVQAHTCAADYEAALPTGFELHFHRDGSVHFSGPDQLTPKEQLQQEQIPLPPQHDVIV
DQPDHSASSSGDSSVINRGKQTDLLKNQYAYIFLTATVSGN
>38C.35
MCPLNGPHKCHPHNGGKARHNLDYRLIYWVCDALSKPKSLALSIYDCVRRRHKVFPFQNA
ANGQRISFKRQFYRCARENVENSVETAARLIEAPEGAATRRRRRRFPIKSSVSHAPISMV
AGAPEGSDGLRGSGAEFDTINDSLRPWMRLSGGDGARFSARDQRKSRPKSKSMRQVQSPH
SNNVTCENVPPI
>38C.36
MKYRLKTFAPRLRVLMYAWEPISPISPQFTQPIHQHRPSNASIKTLSAVPVLELFIVCLT
VSDEEEVERPQASNIDVHSIQMLNVCLGARKIEQLVISRVVVVAGVREPEPKPENQTKHK
ANGEALNQVAIQRQLIVFGAGQRRQQQQPKLQVEVAATVACCCRCCCYWSIRHTNVPGRT
EPIKVRACQLNGTVCIGNCSSHGVDFTSKIFIPNRCPDVKNSLSGPIRMKLKSAPTLHCK
VQLYENPFMAMQAQQMELAKPLAKLMEDIGWCGDSQIYRGGLAVSWRYRERYRERYWERD
WDSHQGAVSSRVESESLDYSLVAPAQSSRPVENRHQGELPQPETPTPPSKCVKRNWIGG
>38C.37
MSLNLQRLQLQLQLQLLRCNRHCSCNSSANDIISELAEIVYTALDYNLPEDEECQVSQEL
ENLFNFMTADETDDDCIDEGIDEGDKRWDDESEEERNDTKELEHIIEKSKYLADTCCARI
CIAANRKQADLVRVLVRYLAYDARWSDRLDFNNFNCGSIASILNNRNNHKTKRFRNHPLE
AHTRIPDLGRVGRVMNLTPLLIEPVSSVPRFCLSAPSGAGGAGWFLSNELYGIDTLLSGN
TEQNHIKTTLPENHYRAVCRALVTETIELRVFLQQVLNNEAGAEKLIKASESSATTQQEL
AKLGFNDWGKKGFPRKSLFSADIVSVSRLAAFDDDDDLARFWVQVIDELRRGVRLKKSNH
ERTPIEYELTPYEILMGDIRAKKYQLRKVMVNGDIPPRVKKDAHAMILEFIRSRPPLKKA
SDRQLGPPRMCEPSPREQLMESIRKGKELKQITPPEAPTLRERAASVFRSHHMPRESDLV
DIGSDASLYCGSDGESSQAQSTSTSTPNPQTSSDQDLDQPQPTPRAAPRASASNNPPTPK
PRQAIRSSKVLPSANSTLSRSRQRLIKVDFSKFQDDDLFYDENSISSSHSTAATHQHHPH
FAEMHRCSQPKMPPYPFGGYMVPSQARQDCRETASLMRPRRTTYDLATQCESRRASLRRH
TIVGCQSNLDETHSMPPTRPESRQSDDVSKETPKRSPAEQTHPSDEGSSTSSLGPWNKSF
MDKQTWMERGDDRLSVTLAEIVHIRSVMTKAELEGLPMDVRVKEDVEKRRVCFLCLRTRF
SFFGPWGIQCKLCQRTVCAKCYTKVGTGLMVNHRAAYLLFSISSQMRIPSEHFRNVPLVL
ISPSLLSSPASSSTPSPSHHAQQAHSSSTGNIMDDQFPKSLIERLLRSESDRKVGLLTAV
RPVNMELMKLIPLFQTRSTVGSAPSSPKHQRSNMSTPGISVGPGASSSSAAATGQAVEAL
HDQATMSSSYSAAMRPSGVHQQQKQHYNNAMSRSMEGPRSLPVHSPAYRPLSNNSTLERN
HLAQTQEQKENLRGEQVTVCNDCQGLVNEITSSVKQKRSSARNRTIQNLTLDLTPVWK
>38C.38
MAEVAETPSVEAQEEVAQPAEAQVLEAKNGDAKKDPAPAAEEAAGGFTKQERAIIRQVEY
YFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEEGLVEI
SEDKLSLRRHPERPIPEHNEERRKEIQERTAYAKGFPLDSQISELLDFAANYDKVVNLTM
RKHYDKPTKSYKFKGSIFLTFETKDQAKAFLEQEKIVYKERELLRKWQVDYLKEKQEEYA
QKNEKRKNKKEAKPEPAFELPKNAIVVFEGAPETSSREEIREAFEKIKDFEVAYIEFAKG
ETKGSVRLTEADAAEKYIAKVEEGKLKFKDEVSLSLRKATEEEEKEFIDKAIEFMKKRRD
FTRNKGKRFNRKRHGGNDHKHGGGKKARGD
>38C.39
MGDIYFFDNKLWYDNLTFFAVFLLSDDAPHAFIASAKLPRKAENTEKLATYGRRIFHGNR
KCHSRSHFLRVSSDRRRFEYIFTYTDTDTSFRYRYTGPTLSEYKRQLFRLLTIRRRRRNS
NEYPCRFRKCAIWRVKRRIHRRGAPQIKSPNVYFRGTLGNVNNKDERCKRKASGLFCLAK
SAAKTNKILRGGGSHRWLWAHRRGERVGVPIACGDPLFSTPTHQERVHFTFAASASKQTL
FGRSWNGCPTRSPAIDPMDYAGGPLNSRNRQQITIARAAAS
>38C.40
MDQPLVVQAEYSFMGSNNDELCFQKGDVITVTQREDGGWWEGTLNDKTGWFPSNYVNECK
VQLPLTETIRPPEEIQEYRSVVLKDLLDSERAHVAELQGLLENFLEPMQQTQILSQDEYA
QLMCNFVEIVRTHEDLLIQIEECNDRVGKLFLTSAPLMKKVHQAYCAAHPKAIVILDKYK
DELEKYMERQGAATPGLLVLTTGLSKPFRRLDKYSAMLQELERHMESSHPDRGDTQRSVA
VYKDIAATCSATRRQKELELQVLTGPVRGWQGQELSTLGDIIHMGSVAVGADHRDRYFVL
FPQTLLFLSVSQRMSAFIYEGKLPLTGIIVNRLEDTDALKNAFEISSPLIDRIVAVCQGP
NEANKWVELLNANNPSLPMGIKRQLSNLSNSSLGHLNAAHYISPIYSPLLSFRFGDTLNR
EQLSQHLDSRGYCTRFSLCAYYSSPPCHVRPLRVTLPPSNYPATAPYANLSAHFARLVKG
GGLRSAIVKMLLYPQARQSIDLKRIALRKRRCHKASAKLKDLNTNQDSGQSELERQDAIE
LPTDSESYDDDFEDDFLHSCDSDPFEYVQFYQNKRNDSMCNSTGTFVDHGTGARRHCSSI
NLIKLDSADTDEVLALNELKKESLVIGSRALRALARKSTTRNSSVHTSTATLELGVGGSI
TNCVEEEPILKVKPSFSLQQQSSDASSIFAARLGGAFTACENLASMPDDLSRESSIQEPP
TPLPASPTERHSMPTIFVGNRFNHSKNTEVYVPTWRDRQEMQNQSVDAKQDEELHSSSID
LPAACLSAPDKLQAELLYNYDEILEKPLQLHRELTPFPGHNLNSDKRVSHKSDSPSTGNA
KTDPNLATRSSSTTELCIDTTSKKRTTPSERSRDSIRRCISYQFLQMSNRPPPPPPPRRD
PDLHLDTKCRCCENSQCPSPRSSDSGMAGSCTITSPDPPNPESYFPMEAAGHDMLDNVEP
ERFDVCGMFREKFLTPEATQDVVDLSEEQPQLSDEPTTPTNRKEEPTCITSAQVQVNTRS
IFLPSSSSMDETNRNVPANNILFSSSSADQLEPQATFRSGMYAHWWKKERLPPEVVRGIA
HAYNKSLPSKDSKDSGSVCSSCFCSLGASGYSEGALYCSVCQNCADYYNGSVTSTTNTTT
TTSSASCPLCSEDEGMIAPTHDSSSLDCPICNGRIASGAEEGKQSEMDRRPATIWPNAAR
PKKSSHIASSSAHPLTNPVRVHYLPKFPMELLNELQNINLTLYNTKIRNENENYNQKPIK
RIRFDLLAALNSLQDLPEGFTCCYVAAIKPHTPTARRPSASHSQQHPGRQQQRREPQPPG
VSGHQLDVASQTEPVVQPPSQLQSVHAHSASTTSSASTTTTKSAKSSGGIRPQIKFSPDT
KQQDSSSTPGVIHGRQSSNSGSGSSSGGSANWTISCLRPTPPLRPSLLNATSGSGSGSGG
SGGGGSSSSNALASYCSGRKNQPTYEEDALVLRVFEAYCAAYQNNARNTIHSALQPWTPC
LPIRGGKLKTSKTFSTSNPQLPFIANVGNSAYLNQHQQQHLQQQHLQQQHLQQQHLAQQQ
PGRQHSAGSLNSSFIWREASPNNFNLYSSSVSSSLNATPAQRYSLSGTAGGSTSIKDYQR
ALSEERATRKSLNRLKSGFGSGYDNVCTSPLLPRKNKPAPKLVAQQSYQRSPGNATATTI
VKPNPPGHPGLYDRRLNRSFETSTSHRYAGYGAGYLMNCGGALRTSTLQRSTPQLAGGER
SDDSDVERELLRGNGAGPTASLELNPDGSKRQSGSWCCGLENEDMTPTLRQLWTAIRQMQ
QDMSQIKLQINEERALRADLQQLLMQHLETSSRHKLSRRQKNDPTERHRYWYSRLHRRTY
TQRWLASILDGSIRSVSMQCDASNPIHGPLKLAGLIFKTVRFEWIVGQHCAGHKSAPCVH
MKAIRSARMGQNARWNWPGQLISKVSASRTVMSSEPKWNGHSEEREMGMGIGIVPGFGFG
NWLAMAMVVAENGPRWVLVNSDGAMDRWTDRLGMPPATRKTRRTEGRDLKMCLEMRDGQE
RRGIYGHDKEETKLRVQRIATPRMLFWLGLSWKWAGYGYKVAAKVVAASCTLQVAVADVL
VLALAVAAATDALQLRPCIKLTVNSARRGVRYKY
>38C.41
MLLLCLLLLLPSVSPVRLPKSSSNNATAATTAATASTESTATAATTAAIRNANAKAGSKY
AATSSIIIVVRSSSYSDLTTCPPWLIHVTLRARSTITRSWSGSAELVTPTGSTLQIFFCR
SAKIRGVAGEPNYKSVNLTWEVEFVPSAHDTDSSPNSNSRADQVNATNMSGDVEPPRDLA
FQIFYCEMQNYGPQRCRVKLVNGTTAEVSQEENEKATDQQEKHEPSGSQVHHFVAAVDNL
RMATKYSFHVRPAAQKRLQAGGTRSSNARADFHDENNEIESGSGHLAGQSIVIPTKGCKW
FPKIEVETGPYFGGRIVVDGGNCGIKGDASDAADKYTMRIDHKECGSLVKPETNTVETFI
TVQENLGIFTHSTRRYHSGMQTVRASFTVPGKNGVAAAYEPNDPFEPDEDQRLGRELRPM
RYVNKTELVLREPDSQRESQSDSESVEQAAVVEQAPTPTTEQASQPRGQGRALNLNEVNS
LADEPAEEHHLEPVVGTKYAKLVVDQSHSSWMPLEVGSPSGGSDENEAVLRYIGSHLSSV
LVTVSLSVIIISICIVLLQRQRIRSPPRSPSPCLAAHLPHKTLPRALQQQQYQCTFSPLG
SPLQLLLRLKRKPANIKHETRQPTKDINCNRVGSGLSGYCCRLPNSVEGRLQLKSNTKFK
PSPESKNPKSGHCRLGLATSFCPSVRMDVEFSGTIKVSYKSMIKMVGRTKSYFVIVLALT
LLIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKNINLVTV
PMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKELYLNKD
NHFDLVISGYFMNDYQLGFARKVNAPVVVLAPSPPSQMLNSLIGNPHDKVEKEKGMTFGQ
RLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGP
IRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKI
FSVLSNLKQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEA
QYHGKPMLSLPVFGDQPGNAHAMVKSGFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVV
KFSSLYRDRPASARESLIFWTEYVIRHHGAAHLQSPLVHMDFIAANNLDIYALIGAISIG
LLLMLKKVVQITCRRLRTKLNKVKKQ
>38C.42
MSAALVQKATETQLDQTPEVGVAQLATISLLLQYDIDNTLNALKEHKKMTLDARLGGEVA
AAVNNNQDKDINRNLPEQTELEEDLRLKSGENGFMPPTPPATPNLQSTAQKRWKILAKVL
RKDSEETVSSSSDEFAEEQTASVRRFKSFDLLRQDSFEDHVSLKCLGKTENWYKYRMQLE
NESEYSVNIHHMERQLTASDLMGFNNTGNICVWPSEEALTALVLSEVASYRGKWILELGG
GFTSLAGLMLAKYATPYAVHLTDGNEISVENVRKTVCLNELSCYTKCSVLKWQEKSARSQ
AEQAKFDFILCADCLFFDEARSALVDTIWYYLAPEGSALIMAPRRGRTLSVFQDECVARG
FRVELATRYNETIWQRHLQLKADSALYDEDLHYPLLLRLCKSHS
>38C.43
MSEEKVFHLPLAVAGGKRRAVGWKTRKNSEVSGMTDLCFDKDQEQQQGCVWRGMGMGMGM
GACGSVLARQPESQPEPGACLNAFIAQLERHARSTGRTHSLHEELSAVEWNPGNWPNFTY
SIGQTTNIGLVAINLSIGKTYRYIQIYVLAKTKGLGGWGARKSQGETESPTCVLRHGGGG
RQPHKGLVRQDRQDNGQLTCTDALTPLRSETWSAQVTKPSAPGIEPRKYTGKLQEIRISD
GSQTQSPGSLDEPICASEGVMGDKGIGCVLDLWPRGDGYWLLCHKPCVRVCISATQLILI
SVTLVPFADEWQDAGWAKTQGRALAAKVATNSMKFNETLVFRPANVAYERRRQTEAKIHV
RKAKQLGRIEHVGVGWHDESHRTCCDCRKFAFIHKKEGEQACGRRKSVGKASNDERGKRK
TIKRQAATRRRRRQTRQPGVLSENRGGAEKRGDVGGKSSAFGGSVLSIGSLLIRVGLASS
KLKFQRLQSGDFTSESLLSFAYLAFSICVNVVGRCQCPEHGRTQSVEAPIPNPHAHAHAH
AHIPTRAAEGKLPAHVKLMYKRSRLVCIRNNY
>38C.44
MERNEQRSADTDAATARNKSHCQNSEVIANRQTRALSAKECESLLPRWQSPGNEHSNEAK
TKVRAEPVPSGSFELQPLRFPPAHFSSRSRQDEGKFMRLAAPVSEMAPRFKAPSKGCGKG
GRGHAVEQQHDCRKSKLSTISHRRNDRKAAVESSGSQRCRQSSSQQQSFGHKLRILYIIT
AFRIKLIIKLIINNNNKQSYMGARPVLNRLYEEHCRCLLVLVPCRGMFTRTPPTNKKLNT
DQIQAILENESEDESRKEKMNEEDQKLAPVGEAEAKKQNKDASAKVEEKFEQMMNTLTQS
MLAKSKQEGQVIIAAEKFEKVVSDCDGKSIPIKKWFEIFEKNAEAYELSEKQKYVQARSK
MIGSAELFLESECVSGYTELKELLIEEFSGSYNSAVIHKKLQDRKKKREETLHDYLLQMK
KIAALGEVETVALITHIVNGLDIKKEYKGAMLRCKTLKELKQEFEIYESLNIVDKPNIQP
KPKQITQGVKADHCFNCGSREHKRKDCTLPTKCFSCNQEGHISSKCPEKVNSMRIHVDSA
RTKPVIINGIIINCLVDTGSDVTIIKEAIFKKMKDVDLNRTATVLRGLGNASTQPIGCFR
ALIKTDQVEASHNVLVVHDSKFSCDGIVGHDFISKFRLICSAEGYTFLDLEADKKQAVEY
SQMFNICEESSFTVAPQYREDVERMIERTYETPPKQIKQCPVELKIIPDGVIKPFRHGHT
RLSEEEAIAVKKQVEEWVEQSIVRKSTSNVASRIVVVKKKDGTLRVCVDYRKLNTMVLMD
CFPVPIMEEVLEKLQSAKWFTTMDLQNGFFHVAVEEASKPYTAFVTREGLFEFNKAPFGF
KNSPAAFIRFVQFIFQELINSNIMQLYMDDIIVYAATPEECMEKTEMVLKRAAEFGLKIK
WKKCNFMQRRIHFLGHIIEGGQICPGKEKTSAVNSFGTPQNVKAVQGFLGLTGFFRKFIP
GYAQIARPLTDLLKKDAIFNIGPVEQQSVNKLKEILVNEPVLRIYSREAETELHTDASKD
GLGAVLLQKFEGSFHPVCFWSRKTTKAESNRHSYYLEVKAAYLALKKFRHYLLGVPFKLV
TDCVAFKQTTKKADVPREVGPWILYMQDFNFQPEHRAGERMRHVDFLSRHPQACMMITSE
LTARIKKSQQNDDSIRAILEILKDRLFQPYKLKGGLLYSMVNGNELLVVPALMEREVIQS
AHEVGHLSLQKTMHSIQQQFFIPHLEYKVKKLISNCIKCIIHSKKLGKQEGYLNCIDKGD
APLHTLHIDHLGPMDSSAKQYKYILATVDAFSKFVWLFPTKSTGQEEVVKRLTDWSNIFG
FPKRIVSDKGTAFTSGAFEQFMSSHNVEHVCTTTGVARGNGQIERVNRLILAIISKLSSD
EPSKWYKYVPEVQKAINCHVHSSLKLSPFEVMFGTKMYTRVEDRLLELLQEEVVCQFNED
RYEMRQLVKRNIEQAQKDYKRNYDKKRRAEYKYKAGDLVAIKRTQFVAGRKMASGYLGPY
EVTGVKDNGRYDVKKAANVEGPNVTSTSCDNMKLWKYIAENADLLSSGSDDDDQEGRINM
IVGNRSYRQSVIEGTIARQQWSRVEVSVAGSRVLSSSRSVTN
>38C.45
MHLVRLKAAKRTTWVPPPMPMIELMAAKAWSDDMGFGLTRRMDGRCHSDGRTLFIHPLGP
HHSTRGIRIPARTSNACRALRLFTQETSLCPRRTIRRHLAGARVYYLNNNFRVQAALFDA
QLGIPARMRMGFGSVSLGPDQLHRANRRRQLSESRICWHSRFPRAKCTPSDLFIHLLRTR
EFVRY
>38C.46
MDDDELIKLIERHPILYDKDCARSVKNAAQKDAAWKAISQKLGASERACITRWKSIRDRF
GKEFRRFQERPDEPTYWDMFPRLLFLKDHYKQGLARNESLDGMRFEPRERKKRTKVDMEQ
ERRRKDEEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVS
EELCYNRWKKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRG
RPPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAE
QATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVP
SAAISDKLLTTVIANMETVLQQSRELQAQIHHEQEQEREQRSTQPANSLLAKAQMLLDGL
SPSERASAERKIVQFLCQCQIKALDGEEIEDVAPCQVIN
>38C.47
MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISIS
LKFYKQLQEHGADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNC
FASVFEKYFDYQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKV
FMQELREGRRASHTAPQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNT
INLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPEPKNTEKKTIT
>38C.48
MDDDSDIFDEMWLESVVIAGFRVWHIIAAVLGVLLLISEYIIAVASVWTQFNRIIAAVIM
VCCCIRFRIPRTKQEIEADYQRKQITKKFREKLQQIKNSEMDDMDLQKVCARIQSDYLNF
QVSMESMNAKQNVKFKI
>38C.49
MPRDLDSGSSSKTDSITDSVSASGTNSGESGVGNSYIPGQQQQQCTYERFCFDRQTLHAY
RRQIIDIRLVALRRGVASHAMRFPPPSLTGDPNEQHRAVASHTSPRDPIRCSVPTRTNAS
NQSDSAVCSTSDVVGSIKFTLPTMFYCLPKCRHPKSLTLVVVFLCSSCGFHLRAPIFHAF
SVFPDSNAFRLLRYNKLSRKKGRKAKSEIQSGVKTSAKVNNLWESSVRPRVLESCQCAQC
FKCAKCASACAGEATTSSTKPSTSTAAAAAAAAAAAAGSGSGQGSGAGAVSGTAPGHQRS
GGRSGQRRRSSSGNPHAGTTKATSGSGGAGSAGGGGGGGGGSGGGGVKQSVSRNSNIRSS
SSNSTMASANHRGGGGRGGGGAVAGAGADGNAIVGLQIGSAWFQRKINLRPQHRGVHLVT
EEILRQMPELAHFSVGLCHMQRCLHTSDAKRFESLFKFYIPLLGMHSQ
>38C.50
MAPTERAARSTTRGKGLARVSFAGEQRQINQQPAKAKPLGGVGLLELELGVLGAFSMADI
FLCGRARSFLFALS
>38C.51
MDTHVQVPIFKGARPWREIGKRNTQPTFFLNNFRGDYVMLNMCKWHQEFKHYPQTKFSDN
ANENENETKLTSDAGRAQQICKLIAGWDLIGNEDRNGTRTRTSTMAMARSESRPPHLVGL
KTSID
>38C.52
MEMMLNKIVPEGLPYRHSCEGPDDMLPDNPDHRRQAVAGNVAGRLAVRAPRPGRIPEAGD
HADRMSARTGPQPAVTRLADRQHKNLAKANLAQQRAAAVIAAGRGGLGGGHQDALAPPNI
PGVETKTGRLLLRQQLHLNLNLNVQETLRDGVDIDDVDEDVDEDEDLDLDLETVTTVPLN
NEQLNAKVTTTTSSSSAASSALAKFNRIIDSTLERPPVAVDYSGLPQLSSATLQQRFNLA
YPELVNQQQQQQQQLQLQQHHQQHDATKQISSLQGNPRLDRGTDAVASTPLTLQAPRTPA
TATEEQLDSGHPHDDADVVDHDDHPHHDEDNQTKRNDVHYLLKQLNSFSDIEEIEIVDMK
QRGQRPPMASSSLATMMPPPSPAPPASPSTQSHRLGPRFASSGDSSLVLPQHQFDDYLFE
SCHYLETNYFAATYRTAMVESSSHEFRPSTNSSSNSFELHEMEPPSVICKAGVPPPLVSS
HPGHPGHPDHPPPRYQFEYQAETRLTTSGVQTELTVESLAKMSNCSGSSSSSSATRAPPF
FRCCYTPIDRWRERRQQQKSSSASSSAAQPPKNV
>38C.53
MRLKSGVLSLLLLTTFLALGECFWPFSKWHGRNDNPSAPPEPKLSPVIFGHPASQYRYCI
AVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVT
RTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGYIRKQNIHGAPYD
FRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVK
RMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEV
LAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVER
LQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNP
DVLKYIRTVMQQP
>38C.54
MAMQKFFSVLLPDVKRELRRGIIECSKRGLLHSTKWLAEMHHGLADVHIDNEAPDEDRTF
SECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFLHFYSSYMAREKRRL
DSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV
QAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLELYLNDDGLKIYED
LQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESDPYRLDNVDTYSNLLFVKEMK
TEMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNPKYLAAWTLMGH
EFMELKNTNAAIQSYRKAVEVNKRDYRAWYGLGQAYEIIKMHYYSLYYFKIAHQLRPYDS
RMLVALGETYEKLDKCENAVKCYWKAIDVGDIEGIAMYKLANLHEKLGDHETAVHCYIMY
CEDERAATDKQSLYQGFITLANYYEKKGEYERAAYYAYKCLDSEDRKMEAKALLKTIDWK
RNAEGQKKVKTSTAVANADTSSEDEMEWELQDVRVRVPITSIATTTTSTTTVAAESASSS
SLISLRPDRNLIQGMRRSQSSRTSLTAPASGTTTTPSATAVTMSTEETPGTSGGPSNPPE
QAPSDDNSSMEISSVSID
>38C.55
MGEATVRAALLAVLGILLIAGCDCSQRFKYEIKEFQVPLDHFSFLINATFNIRYLYNDSF
VDKSNARTPIFFYTGNEGDIELFAQNTGFLWEQAERQRALVIFAEHRYYGKSLPFGSSTF
NTSLPEHLAYFTVEQTLEDYAMLITFLRNDRQMPVVAFGGSYGGMLAAWFRMKYPHLVNG
ALAASAPVLQFPGITDCDIFYRIVTSVFQNAYNENCTLNIAKSWKLFETLGASEAGKKQI
SDAFHLCNALKNDDDLKKFLDYVEEVYSNLAMVNYPYNSSFLAPLPAYPVRQVCYYLKEL
HSTDADLLHAMSSALAVYTNYTQSAKCLDISVNSNADDSGWNIQSCNQMVMPICSNGSET
MFRTSSWNFKDYAEKCYKNYRLTPKPYDIILRYGGRNLEAATNIIFSNGLLDPWSGGGVL
QAPNDKVFVIILPEGAHHLDLRHSDPADPPSVRDARDKEAAIIARWIQDF
>38C.56
MWWVVRAQLSKRAQRKRKQSSSIRNVSQCNEVTPPVPLVSHEISITIIIAGLVARLFSIL
NWQQSLQSLLRSHIAVFESSAFIYIYTPFSYHKSSYAILQGLIDSRIRERLCGRVLRFVV
EETKVNDQGNYGENTDRGTGEDAQALEAQFATALFDYEKCSKHMLQMTAERAKKVLPGPL
ILFAVHQRSTTTRITYLAHMCSTRSVCRLPTQRCRERKRRSTRDRLVIFLNDHIAAAAES
SASSTPSASSAPLCMGIKCPGAVAVALAVAVALAQHRTK
>38D.1
MPVGEGIGITCGSSPAHHQSYGFVRLRLRSTWNGSSEQRQRTESILGQSYTRLYGHIYGG
KTRRRDKAINMYIRKVPQSDPIRSHPIPSHTIPSHPIRSDPCRDEPIGTSPANSCRIVYI
YTKLNNPQSQEYPVWCSEKILDNSLKVLENERKLTPSLCAVVILLKYRPKRCSKAIENFQ
FLREGGLPVIAIYGEHRNNAINISDPDRRRAEDFQIAPWRNRAVHLRRPGKRLQSAGREL
QIASMCQATMRPCDHVPARRLAAHILPIEGTTQRGYCRSGCFKHLYKRVFTLQPEHSRRL
QFAPSTPRSIDRIVSDRIELGFCSGATSPYLSDECGDEKSLSPGFLPDL
>38D.2
MQPQKTVANVLQLAPFSLQLPSVVVIIQQIIWFCLFRTTIIIIIIIIFGHAEPVRIAVKH
PGSRLEHSKPSVQEHVDPCAPKWIYQLEIIAEHVAPSSGGGRHLGGYNLMQLICKIVTLP
LTLHQPSYLSTKRQQLRDGKTTCTACAEWCICHPLAALFLVSFHIFHFPFPGPLSLSSAE
RIKSKGKVR
>38D.3
MHNANAGNAARSRIGILASFVLVEVPACPRNNDCGHNAHNVLIITAHSPRSSWGSLNVLS
GPSKQLPGRRTTKDAGHRTQDQRVDTAWPVQFAFNVRIVLLILSVLIKTHTTFLELIFAL
EKVHLQAVETK
>38D.4
MSTMDNFFYKVQRKHPTILDDLRAVFKNSQSDSPQRSITLSQIRGKNSVFSSRGDNFQLQ
LKWQTLRLFALRLPIVIWTMAAIKRRQQTAPGKSENLSANRGTSDSVLLSALRLHIKSNV
FAAAAL
>38D.5
MSNGDEVIEDDEDDEDDDDDEDENENEDEDHDDDNKDIVVLRTATARCHRKWPATSVSGR
RTANLEECGNKRPQKLNDIRSGCGCEGNAFVRRAQIKDYAINTFI
>38D.6
MASIRIRIRFIRQHLAARSVYECIRGWRRVLCLINPLTAFDIGTFWRSGHVDTFDTWPAD
PTAPAAVAISLHDVHAASAEKRRELPKLQIKLKIQRAVCQNQHRVEACSSGHLYSCTVVS
WPWILVYTRA
>38D.7
MCTASMAEQKRADKFICNHTHTHIHRQWHTKAMRMYSVYKQIHLQAKAHIKHSGSRTGLH
LTIYLQLSKLKPHTAPQLGELQSHNHCDGHGHGCAEGLARGMPVQRTTTSQYPWQSVASI
RPGHRGHSKKLMRK
>38D.8
MHRERRRQIHSGAVIGQRIAFALNRSRSHDRTTHSKPPRATHKQQQRTKSHRTTPSHTPT
HTHTHTHRKFSHLQAEF
>38D.9
MRLLSALALVRAITFRFDFDLLWHRQRHRRFYFIFICALPAETKFKLFFPLASAGKQILN
KVERDKRYLLQSDCNESALRCKTQRQALKSNTIASTMQQQEQSVLVEYSGDAMAEGGFRQ
KDPTMVTVATSGCRWMSCTCAPSTRKHRCQFLALACWGISAAIVCAVSETKEPLPYLHVS
IVYPGTARKWRLDFYRFNQAATAAACEVGRRHRPMPREYPLFVVVQLPAGYLLKKSGVSE
LIKVHQAGSPLNTVLIEASGKDLCSARWVKGSDVGMGNPIQPQNQARRLVSKPHTHTHSV
AHFEPVLIHIRVIIHADCMNISAFT
>38D.10
MALASSSGFLLQSSAPEFLPARNLKSCGNPGWAAGRLCSRGPGSLLHRLLVAFGKRCQHL
RGQKWNGPQTERVKDGGISTHMAQRPEVVRVCAPAEKRNCKQSRAADLASFAWLWAPLSP
FAPEAPTVDFSHGTHFTLGMQNARLIQCKMQNAGKPTHNKETDAGQMSYVDNSEAVSLTS
GFDVCLAHHNRTGGAIENRIGLNSARLLTTRLRNMSLLPLWAIDLDVDVDVDVDKDMHVE
DQGKRKGFCNFYVQFFT
>38D.11
MNATHWRYCNPDHQPPRYFSPIREPSPWLQLKLELLPAALNTVSHAPSSFRSLPFPSVPF
PFPFGSGRVGLDRVEGVLNRGPSTYIVSDPAGAAALAKAKRRGATIMQLAATVPKLLAYL
LPLLHRSIQYV
>38D.12
MMLNNAHCGDVDDDEDDDEDDDDGDEGTSTVYKHNKKIPLHFPFHRDTDKLRIYGDISRQ
PGEFSKDGAKRTRLHSQKQLKLLKPQLDEDGSKGFVIELESRRRRKETIWGVPKWAAADV
FGLSVGLFFSADSDSLLGCGSGPKSRIRARNLSRMSGQRRCQHHRQCNHHLAHSRSKASH
LGTGLLRNWGNHPYRAQARMPSPHPYTDIPATFARNNKKPPKAGSRMALIFYCYYPVYPM
FTHTHKHTNRSAHRRGGAHVRLCDGVRISCGSQMRVVPRFLPSHCYFTIHFPNGENNYEC
RARESRALERFLGGQQLPEWSRWSGCEYGARISREKITPPEEGTESLTDGLVRPTDCQPE
AATKSARCAGGCASGFTCQAVNLTHQEPSSHPASYPDIPVSGWRRTPGAIKNFARKPSQV
NMLGGEVWRRGFLLGFRTLGKKFKRMWLEMVSRCISKVSKLLQNKQSNSRQHQRQRQPPE
QFVPRVSRWLVGECAKYISATTGTATDADDATRTIKSTPFAVAHLLLNN
>38D.13
MSFEMSEYKKPYINLCPMPDVPFFVLARLRLRLRSRCLRLGAKTLGAPLQLSPTFLSAFS
PVSRIFS
>38D.14
MLTLIGVCARRVVVAVSAVMVVLVSASIPNFVAFFIVCHFFALYLQQYRGKNFAGEKQLK
QAAEKLLKNFDNLHKTFTSRVTLAASMFGDNSQRQRSSSVAAAPFEATTKPILRSNCGSG
SAASANGQKQSCNPAPVCVCGYNMWSKLRFVRGQELVYATSGSPKDSIAIRQSLGFVLNT
QALYRERLGKTHRNSFTSHHSTGCFDSIAFHRLLSRRSSAYIPTVKCCNARAILQRATSE
NADARRKLHASWKAENARLVSALSLSLSAAARAARSFSRARSAEILLMLLMCCCCCCRCY
GSAATASLLLLRCCCCEGLQCFWGCAVGPWAIARSVVVACCRWPGLLSSVWTAPPPTTTA
AAAAAAAAAASACNLQHSHHGNRSRRVAFSPRPTA
>38D.15
MSVQFAEGVDGKRFSLASSAFVYCRPFVWAIYFPGLIEVRVPADGEPQPKGRYDTGGIQT
HSSGKPNLVGFYFQQPVKHSARMILIFFKCEYVKRQRGQCDVFIAFAPTVSGIFLLDCLQ
VLCPVSCVLAILQLSANYRARLTQKQQTPRATKTGSNECGASSKHPYIISVPYTVRVYVC
GPHAVTGRTMDVPPLLVYALATY
>38D.16
MRATLPKNQVGSGGFPLRVLIALDGERWTKKSCISVAGACGNRSPTMPNKTQHNLCQKPV
QIELNQAESMCEWARTTTRTRQQGQTETGNGRCVLKFVSACLLLKFNATLFVDLQQEKRI
VKSCVECRAVWDVPGLARTKNQINRPDQKEMKALIKKEIESGQNLAPKINKLKLTAELDF
LKENLQQRKPNTTTHSAKIEIINEEITENSTSPKPKRPDVCMNDCPRPLDLPSIKEVIEV
DPSAGPKPLTIQEYKARTAAREQPPKKKRGGRRIKLLSARRLNIELLKTATNEEDRQRYK
ERLAAINQQLRGAKDAFDKSYKCINKTALIKTQTLIFHIKVLITQYNTLQNLIVTNQSKL
TEEHKVQCFKVLSSFGKRLHNTSVRHSIIIEVPTELTKIAEFDESQLRDLDESQPLEDLD
IESDIESIEELKFNTVQPNTRNMANALEAQRAYVKQVSATVPEFDGKKLHLNRFVTALKL
TDLTKGDQETLAVEVIKTKIIGPLNYKVEHATTIQAIITILQANVKGESPDVIKAKLINA
QQRGKTASQYVTEIDSMRKQLEAAYIDGGLDADNADKFATKESISAMTKNCANEALKMIL
TAGTFSTFNDAMEKYLHCSTEITGNSNTVLFYNGNNRRGNYNAYYRGRGRNNYNHNYNQN
YNQGYNNNNRGRGGYRGHGNNRDRGIGQGTIQSIGTVDLDIRIQDVLVPHEFHVVPENFP
IPCDGIIGIDFIKKYNCVLEFQNNKDWFTIRPNNFSRQISVPITHNLDSNTLLLPARCEV
IRQVKLLTNEKTVVVPNQELQPGIIVASTIADSKNALIRIINTNNKDAIIDSAKIKCESM
KDYDIFTTPVEKENRTEEILKQLRFPKQFNNELTKLCTEFSDIFGLETEPISANNFYKQK
LRLGEKTPVYIKNYRMADSQKPEIARQVKKLIDDGIVEPSMSEYNSPLLLVPKKPLPNST
EKRWRLAVDYRQINKKLLSDKFPLPRIEDILDQLGRAKYFSCLDLMSGFHQIELEKRYRD
ITSFSTANGSYRFTRLPYGLKVAPNSFQRMMTLAFSGLEPSQAFLYMDDLVVIGCSEKHM
LKNLTNVFELCRRHNLKLHPGKCSFFMKEVTYLGHKCTDKGILPDDTKYEVIEKYPIPTD
ADSARRFVAFCNYYRRFIKNFSDHSRHLTRLCKKNVQFEWTAECNDAFEYLKTELMKPTL
LQYPDFGKEFCITTDASKQACGAVLTQDHNGQQLPVAYASRMFTQGESNKSTTEQELTAI
HWAINHFRPYIYGKHFMVKSDHRPLSYLFSMKNPSSKLTRMRLDLEEYDFTVEYLKGKDN
HIADALSRITIKDLKTINREILKVTTRSKAKQENSCKDEAIVKIQEEKEQTIEKPKVYEV
VNNNDTKKYVLIKIDKHKCLLKRGKTIVSRFDVDDLYSNETFDLNQFFQRLISKAGMHKI
TKMRISPSEQMFQFVSLNEFKIKGNRVLEKVELAILQKVIIIDKNDEAQIKEILTKFHDD
PIEGGHTGISRTQSKIKRFYYWPQMTKTISKYVKTCLKCQQAKITTHTKTPLTLMPTPAT
AFDTVLIDTIGPLPKSEDGNEYAVTIICDLTKFLVTIPTPNKSAKTVAKAIFELFVLKYG
PMKTFITDQGTEYKNSLMNELCKYMHIENLTSSAHHHQTLGTIERSHRTFNEYIRSYISV
NKSDWDIWLPYFTYCFNTTPSIVHDYCPYELVFGRLPRQFKDFSKINKIDPIYNLDDYSK
ELKCRLELSYNRARRMLEKAKADRKLRYDRNTNNFELKIGDKVLLRKETGHKLDKRYEGP
YDVVDIGINDNITIKTGSKKQQIVHKDRLKKHK
>38D.17
MRPLLSSAGLGQRRVKESMGMVVEVEVGMSLLLFDPLRCANKSAAAFNFCCPVVWQADVR
ALCWHIRLHYETNTRTHKKAREEPIKQMKIALSVYFRKGCGQYTQRYYVYVMYGRDIWPS
CPRLTDAAIDGAPCRQSAVSANLRHELSYRNDALHPISDSCSLLSAADATRLCRCDAMPF
LSSFSIDVSADVVFLMRGNDAGAEWEWQWEWSGNWLRWVFKPCAIIDVSAGLDPLAVFGA
ASAIGTTFAQDLLAAPRSPMAKCEPHFRKVGELSYDGTRRRMGCSGNREHHCAWHFRIQC
GIANATDKTRMAKEWAVGGLTRLCHYKLKDISSRVLPAPKDLSRDDYFRFVPQLIEILTS
AWDEGRRLNYETFDICCKSNTKLGAAVRPPFYFFLSLRVAETVLPA
>38D.18
MANGQSDRQARNPASRIRRRPRPDLDFIASRNDTPSVRPAKPLKIGGASRLGPPCSKSFQ
HDAQQEQEEEQPEQEQEQEGCTLLVAVPGSHRTINTVACSRMSVSARPWAPLLAHVPIIV
IRALLPFALCPLCRVLGQKDPAAVAACCFCIFYDATQVAQIMHKPMKHATGTFANASRSR
TTRPFSPAIFNFVRFSFLYYYFLLFVCRTLMKNFASGKCKQ
>38D.19
MYLQVLLILVRTQVIPASAQLSFEQIFDLKSQSDAEFQSPKDSERLDRRLAQAFKPNLRV
GRALKGGQSGSQAGRQAAQNFANLIKAKRLSGSGQVATPFTLNFGVLYGRKFQRTMLQSR
GKSGREEWIFQENRATEWPPLAIEALMRDLTTELLSGPLCESYANNQDLKSYGIGGWEIW
GWEGFATAFGIVRINKLANRTGGINFNLKISASINVLVRDEANKICQQKTRMTATDFKVN
ENRKKARWGTSQNVEKSGQANKKVREGKGRRRRDRRKRQETRGDKQKWRHRWPLSKQRLA
IEANDSVAGKDILPSPICTDKLQLPQTKFAARRGNSRVHEENSRVDGLLKPFEAIAASGS
GKQVFRQRHRQNSKRPKTLCGFPSCSFFFFHCGFTAAVLWPAHNFAVSTSFPLRLCLFMI
YVVSPWSYKIPGLQARKEENMEEKTTCEFCVGVESVEQVKQAELEVRDLDPWTMPEGYAL
SRERRARQSTNQATNQAACYMQLKRLRDPDEHRIPPPQPKKPPSATTVRKTKLTRLENPL
VAPTYQQQGNGCGLAKEKVPKMNAKRFTRPSKTQAAEPAPKDTIHDNAKICNHFDLCRAS
KNPIRAAGGGNTQVVSKYQSAVSVSNQPVRSTVPRATHPKLAPKEVREARELIFKDLKEA
RAAKEPKDFRHVKETKDQQDPKEPKEPKVPKEPKDLKASGARQNINRTKNYFDKYLKFAF
DLSTPDGIQKLEDHFFPNQDPTAPGVSNSNREK
>38D.20
MRQNIYEPLTSTAGKGEKRGERIICIAARWNACIAMLENDNQGSKNAENE
>38D.21
MHRSGSGFSPGGPTGRSFGSSVGGSTKRIRRRMGSDGDGTGWARDGTGWTRNGHGNGRML
SSRGTESSPCFRIRTNVSVKLTN
>38D.22
MQALGPQQQRRQLAKSNQQKENASFSRGQCASPLTLTHTRAYHSEELSLYNATVNNRLTQ
MRCINQMNRIAAHNNNACTHRNIQPTWRMRNCAPGLKSILPVQSSFALAAIAEQLQQSRM
NSRCVECTSIGVTRKTSHDPQDHSIENIEKQQMPKTYLAKWRNNNNDNNSYLCDFVAAAA
AICKDNKINVLQGLADSAVAYASRTFAQMFCDNKYYSVPHHRDRDRSSVLRPWSLVLVHV
LLWSFAPRSLAFGPMFRDRMRSLWTGRHFEKCCTYFCIMSARKCQPTNDDNGNDNDDVDV
PRFGVMTERIVADRGVAAERSI
>38D.23
MKIIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAEFSRWIEKVNNAA
ARSNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRSLISLRKGGKRCVRFYQHQENEL
KNAYKFSNQKKEEACYPRRCGNAERILRYLASPTRRRLAQTGLLTAPEKQRSGTTINPCD
IGQRVWVGLSEKKPKTAAPHKTREATRGAFMVPPICLIDGNGKLLVCKLQTGVRWCGEGY
LRRRRPLTVPVWFQESAIHGGCCQKSGCSSGLRFRMHQMMWDRILDALTALVVPAYVVRI
VRTYFSERVLL
>38D.24
MDRLATWRLHNISNKYKYLSTGNPEFYQWIERVNTVADEFNHYNKHRQRLEDQITERLIT
IRSIIAIRNASKRCLRFYLNQEAELESAYKSSNERKQQVLYQNSLAFRTANMKFMAICLL
ANIGYSKYIVHLYRYPKTDTHLSNIYAVLGTTIGQLNDEATIRLKGLVEKYKLQALSNPE
FSQWIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDLISDIMAKVP
IKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCETTKVQSSELSESSENPDEYS
YY
>38D.25
MDSQRSTLVHWFRKGLRLHDNPALSHIFTAANAAPGKYFVRPIFILDPGILDWMQVGANR
WRFLQQTLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDA
AVQKLAKAEGVRVETHCSHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKVPKVLGVPEK
LKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPEELGPNKFPGGKNIVKLLITTTTMWISF
YQTGETEALRRMEESLKDEIWVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKL
KEIIKRQPKHSQPPVSLIGQLMWREFYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLEA
WTHGRTGYPFIDAIMRQLRQEGWIHHLARHAVACFLTRGDLWISWEEGQRVFEQLLLDQD
WALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEPWK
ASLVDQRAYGCVLGTDYPHRIVKHEVVHKENIKRMGAAYKVNREVRTGKEEESSFEEKSE
TSTSGKRKLVSALETPTKTMFRNLSMLRNQLALHRVRVARSTLHSKMSTGLTCLTIDRPR
NIDGVTVIDININEMAKTDVEFNRNFVNSLTLMDHTPFKEVTNIVDADAVESPPAENPIS
GDTVEILPTGAPSSVVGVDGNPIVPIEIDGWNQDEEDPTVQKNVQDVDIGNDDEYKAEME
LRVPEVREGRTEYKGIKVTLPESANQDVGTYRFRRDPKDLEEVGDDTRLVRYDK
>38D.26
MALQAHIRQLLNIKRGKHGGKMDLLDSILNAMDAPPANNEQQKTLIKKQREMLERMQNKQ
KEELLRFRKYVDERMGRFAKDDRRCIEFQPLDKVHRSVIHEVAENGGFIAMSFGREDVDR
HSVVYKKEHAPGEDEVTARRNGDGWNEEIAKEYAERRRERLAQEQSDKEASTSEAASSGS
STSTSADQDSGEVKPTTNYKAKYAHLIGESAALQAARKTETNQSYGFVPSKNKKDVRSIE
QTLADIQAKKRLRLAQQQELEQEQQAQEATTSTEDP
>38D.27
MRFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFL
FSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCV
LMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHP
APNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFEL
QNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDPDNERSGEYIKVVESQCE
TDGFVNEQWTEPAMPGPVPWKTIIIILLLFIGGIVCIAFATLNWVTDTSRERSDRVWALG
IIGALTFIPGSYYVYVLFCIMLNRNGFTMDEIRRLG
>38D.28
MRAAVGLMLSHGAGGMEPALSRPDYEQSALHHSCLLVLLRGVGPSRARVLQRAFEKVRRV
NHIRVNGVCCSSSLAIFLITNNSICLTDSSGHPRSIWIRFVHDHPVEHNDWGDFQTHRRL
LGLVTIGKFDSQIELNELCRQHESLKVRYGSTLYESRAIFFGPDEQPLETIGEVLGPPAA
GGRRLQDEFTTPSNFKAQAFFYREQDSCADLESRIGDFASALFWVLESRRLERSREKADK
VSLLLAPFEKRDFVGLDMESRNNRKRCVGRVMKNLADLSLQAGLVDDALSLYHNANETLR
SVGDSLWVGATEEGLCAASAMLLYPQMRETETLHRNSSLQEAGTSPLKNTPEKWRASDAT
KKISASDATANNVDSNQPQQRVTSNSSSCSSVSSLVTTATNSSASDTPTTSSSSTSTISA
APIPGHQRNGDLPGNILKAEEISNYYRKAIINYSKYRHAATIETEAALKASRICIEQNRP
LDVAMFLQNILYINLSMSEAERVKRFEVITDLYQQIGYQRKAAFFQRLAALKHVQQGSQA
PDWNQSYRLMLGSFTGYRLCLDPLEVIENAAGWPALQIDLVQTLITAARRLGHSALATRH
MTFLLQTQWDNMSPTEQSEMAVQLQNLSAQCEGSPVPLVLENGTVIPPANLTDLPYCIDL
QVKDLPAHLRPQRIKVAKADSGPFLFTPIHFNSVDRRDKKKDKNKIAFQWVQNDLSEVTV
RLRNPLPFELPVTDMRLLTNGVVFESLPQTLVLQPHVPTYVALHGTPIETGQLDLQGYST
HTLGVKSNCRLKHMRGRSFPPNYVVDVIPALPRISVKTSLPQTATFSNMNSADIVVTSAS
LTLYNGESSSCTITITNESATLPLEHLEFSINSNVEQELQQKIFRIDEEAIKAHLPVPPQ
GTIEIIVDVFAEADFVCPQPPASLHSAAAPGDYGASSLTHYSSVSTSGHASLPSRVGSPH
HRRNEPQNSSFRSTISGGPPSLAALTLHPGGGGGVGPSSLGSQYNQHIEAQVRFKYSGGD
ALTAGYCRQCAVSFNLELLPSVQITSWDVLPAEVASQFYLVLDISNLTAQEMSLNYTDTK
NILIEAKESCRVPIPVDRCSLEKVVAARAAEVAENLERELCFRTQLLSFNDALSKLCSIH
IAERVKIKWLLTGTDIQGIASLRGIVLSQSMVDLTAVSPLEWAISFQDTLVQPHNEIVCT
VGQRSLLSIQLANQSLQPLRNLVLSIKFYQDYLNGMENYNLETRVAISGPNRIAIPLLEK
QEQKEHTCSVIFFTPGRFKASIECTSNPQKQSEQPSSLLTRSCPAEAESVGQSVMFSSSY
DEQQAHVWKFIPPIEVTVVEQ
>38D.29
MNLLPKTREEFAQTDYWNEFFKKRGEKAFEWYGEYLELCDQIHKYIKPADRILMLGCGNS
KLSMDMYDTGFRDITNIDISPIAVKKMLELNAKSRPEMKFLQMDATAMTFPDESFSVSLD
KGTLDALFADDEPETRAVVENYFKEILRTMRNGGRYVGISLLQEHILNFLLDFLPKHNCM
LRIVHCLGVEQANKEKNADDALTLPVFVVVATKFKSLPMPVLEFGFGNDKMQRFTTVSEL
NSAVSSVQKAALVCNGLARSNIAGHNEVIMDLHRPSEQTPRYTIHILDKPPARGLGKYAA
FIVPQGREVEWIFSTPAGRKKLQDSANFQRLAVVTLHRDQVYSTLDEVKQELADSIKNLS
PAGLTDQIPYLSLGSDVGKRETLICGFSKISGDFRIEEVEANGKTLRRLIFLSNQFVVQS
EALVKTVKIKGKKDRKKIDFGYLACQHHLYMSVGVQLATTVQHPKRDVEKDVLVVGLGGG
GLCSFLHAALPQARITAVEIDPIMLEVAEQYFELKQDKRFHVVIDDGLDFVERCRNEDIH
FDAVLFDVDSKDLSLGMSCPPQSFLATKILQHIKEIIGPKGLFMLNLVCRDESLRTEALN
NLHKVFPAVCSYKLEEDINEIIYCANDEKYKTVEQWKKNMGTAGRGLNSAVKETKLASED
ALEVAEFLSELKI
>38D.30
MERFLSGFSDCSCCFWLYDNVAAADSQIPSRAGDSAKDAARKTHIEPEEPAAPPRPEPPP
PPLHNGAGVLLPSAQEGVPIVATSSSSSFAEVPQTGNRPISGDTSVPVKELPALSDQQRT
KSHSEYISEIDLAADVGGASSSTAQVPNNQLNYNKRSSAGKVHRFSESQQLDQPKQLEQE
EPATGQPKAPELQEPPQLPQAEESSQIVHGDQAIGTYANVADLQLRRIIYCIDKTADLLS
MIAQRSARSVLSHVEMECNDRSYRLASMSKYLIDCERGTGIGGSEDRGAIVGAKAVSDTL
CHPNAAVPRARNTRHHPYGPQNCLARKIYFPPLPPDGWRGGNLGDKFAGKMQPPLLTCAS
AGRSEMIARCRSGCGCGFGLGCAEWCDRVHRYHAGGATSSSSSRRWVFGIASRSRIHYLV
SSLSFFPEIITELPAVTITELPLDRVMNRLDSVILDGSPATAGNHSDEEQHQQQQQPHED
QPMQVSEADEETNFDFSTCLILDEQMPKINDPGGGIQVEGMVTPEAATVGETQESSEELQ
PGSAAFNGTEGTANLTNANEEVPMPVFSEWAQKQMEAEASREQAMELEQQVVNKSAQRKN
NTGSSSGKPPTLKLRSKNYASPDCGAKIIAHNSESKHTEAVLTQSTDEYMLSTCESRIWF
VVELCEAIQAQKVDVANYELFSSSPKNFTVAVSKRFPTRDWSNVGRFAAEDKRTIQTFEL
HPHLFGKFVRVDITSHYANEHFCPLSLFRVFGTSEYEAFETEIRPSDDLDDFYDDYGAQE
QKAAVGSGGNIFQSASDAVMQMVKKAAEVLVKPTKALKWSEESVLCQTPAFEAFSCINCN
TTLVERINSLLSCQFQQLQALLSLSHLRSDLLNSRVCQEEFGISLTGSEFASKMGKEQSY
FLSMLPAEHVGAMCKLIQAEQNVTDHNHTKAPSLKQHVSSPEPVQDNATATGVRQDCENS
KTPTKEPLTPSLEVVVPEVSQEVPSMEDQSSTSSETVSTTNSTPADVNIFNMPSEPEEVV
VKVQLPPEPTLPTTLQPSDVESFTDAPSTNALPGSSEAVANGDLGMEEGNPANWDGIDNL
LTTTVASITAGGGAAAAAAAVVNGNANIGGAGIVGAGGPASLSSVNMQQKLTNGAQSESV
FIRLSNRIKALERNMSLSGQYLEELSRRYKKQVEELQQTLTQQTLTVRQLEDQSRRYVEQ
EQLYQQHSAELAGEVRALSYQVQACILVIIIVGTCIFLMLVLGTVYYRKLRRQQQQLLKK
DQAGHPPVAAKPKLDRRKSYEQTPNQSTPKQRRPSEEAMLILKECGDSNMQELDPPSRQR
KISVCYGSNNNIAANMAIANTNGGASVRNSLHRRKGAKHSWHNSLDTTETSCGEQTDKFF
DVDTLKSIKQSCGKPGKKKSLQQLKPLGLKRQESAPATYTPDLQAEEPATQSDFDESLML
DDDDLANFIPTSDLAYNEFMPEGPSGYQIVDTVDGKPGKEPGTKKSRRLSSPAFFKSPFS
KSKNKGYSFNGVKNSHAVHEPTSWEWYRLKRSEKHQQQQQAKLVSKSLPSASLDSSSLSE
VNFPLSSSTATTQNSFRILGEAILSSGEGRITPNGNGNAMSGGLASSSSGSGSGGSTTSS
TTKKKQRALNNLFRKAFDF
>38D.31
MSFLRGSVSYVWCTTSVLGKGATGSVFQGVNKITGESVAVKTFNPYSHMRPADVQMREFE
ALKKVNHENIVKLLAIEEDQEGRGKVIVMELCTGGSLFNILDDPENSYGLPEHEFLLVLE
HLCAGMKHLRDNKLVHRDLKPGNIMKFISEDGQTIYKLTDFGAARELEDNQPFASLYGTE
EYLHPDLYERAVLRKSIQRSFTANVDLWSIGVTLYHVATGNLPFRPFGGRKNRETMHQIT
TKKASGVISGTQLSENGPIEWSTTLPPHAHLSQGLKTLVTPLLAGLLEENREKTWSFDRF
FHEVTLILRKRVIHVFFTNRTSSVEVFLEPDEQIDNFRERIFLQTEVPLEKQILLFNNEH
LEKKVTPRTIDQPIFLYSNDDNNVQLPQQLDLPKFPVFPPNVSVENDASLAKSACSVGHE
CKRRVDIFTSMDILIKKGVEHFIEMLVTTITLLLKRSEIKTLLTALENVKSDFDGAADVI
SQMHKHFVIDDELNDQWTSSMHGKKCPCKTRASAQAKYLVERLRDSWQHLLRDRATRTLT
YNDEQFHALEKIKVDHNGKRIKALLLDNVNPTVAQIAECLADWYKLAQTVYLKTQILEKD
VRDCERKLNGIRDELYHVKSELKLDVDTKTINNNNQLAKIEERNRLRVMQQQQQEVMAVM
RTNSDIISLLSKLGITNGSLESS
>38D.32
MPPIRQLRSWRVTPIRVGPTNMYANSPPIARYSVIIIGLHRESCQQRNAHNRPKTPRSQE
GKLPSWLHIFMTCLNNNAELGIQTVCLGSEKRRLHFAGKLVAQVTPPPSWQETNASVCVG
SKTPN
>38E.1
MEESNHGSAGCENVSQFMLDDLQLAAELGKTLLERNKELETFIKEYKIKGDEQELEILHL
RKHINAMTEVNDSRLKVYEQLEVGIQDLERANQRLNLEKNRDKKQIKTLTTNTEVLEARC
EELSQLLSDARQSLSTERRKVDQYQQERYRMQHSTEGSVSSHSIQSLCKEQSVEFSKLDV
MAIANSTGLEDISFSNATMCERTAVKGEDNEELVKLLSEMEVLKRDFLAEQQRCTELEEQ
LVTIIQDNQGLQTRLLENSANEGTMSMHEEFSLLDDVRQGQMCSRCLRDINESNTNMDDQ
SSIAPTEEIYEDDDRSILSESTSKCDNSGADYKERFRIPEDLNPNSSDKPNPYRDLVEKY
EALVEVKRTSNAVKSNFTSNPDGKTMTESSQGKKSETIVNSSKESDLMLDSTRKRTPTEF
SESETTSSGFSDETSNKSTQTDERPSYFLCSISNGNDCKFSIYDDVSPIESHFRNRPEYR
ELFKEIFGVLKKAADNNEEDKLPSLHDDAQITEKLPLVAAKVPPVTPEREESPDDFIDDT
QSVVSSVISNQSIAMSECVTKLERKTAKKHIFDVRNQQNQSSLTQSTLLNSSSKETTVGE
PNYKPIRENGQILTPLKREPLEYLTVGVGIKKKNRRKHRNQSSSGDRIELFNSREFTPRN
SPLAMNNRGGGQGSSKMCTDTLNAEFGRSNRRRTTPSSSNWNGSPMVIYNKNMNTPQTSR
GRVIELNGVEFYHNTVSQDLHKLKKLDLSYAEVLRRADAGEHGPTRSHSQRQQHNGANIR
KSHHHQFRQK
>38E.2
MLDALIRAAELVDLVLLRPLASVIDAVITGVYYFLWGSYLVGFCLVEGSRKGWNLLRCAV
RNINEGIRDLGLITLDVADYFYGGTKGGLKNVLDFGHCISRFICNLLIDLGDGILWLLML
LPRAILFLWDCLLDFVVHSIVAHGLSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQ
RGRIEISTKTQSVYLWTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRH
LCLCKECSLQLVLLLEDRCPVCRHNITSFLSVYV
>38E.3
MQIVKNDLAGAPRTLACILQREAAKIFIIIKIRTPATWSGRRSVPCSIGQHNLLHFMCRI
KRRWRCDPRSGAAALTPAPPATEPRKIKPLGAGKLKVGKTDSNSDSNSNCDSRAAAAAST
SATSATSATTLAATAAATAAAAEAGGAASAAAAAKISQVRLTNQATTSMLLLQPNSSFSS
LSPFDNFSTQTASTTTTTSASAAGHHQHHNHLLHQQHHNQQQQQQQQQQQQQQQQQQQEH
LQQQHQQQLVSPQQHLLKSETLLSHEEDQLISNLTDSSVVSHSELFSDLFFPSDSNNSLL
SPTTSGYPDNPAEDLTSSIENLTKLTCLRDKRLSSIPEQQLSSEQEQQLCLLSLRSSSDP
AIALHAQQQQQQQQQQQQQQQQHQQQQQHLQLQLISPIGGPLSCGSSLPSFQETYSLKYN
SSSGSSPQQASSSSTAAPTPTDQVLTLKMDEDCFPPLSGGWSASPPAPSQLQQLHTLQSQ
AQMSHPNSSNNSSNNAGNSHNNSGGYNYHGHFNAINASANLSPSSSASSLYEYNGVSAAD
NFYGQQQQQQQQSYQQHNYNSHNGERYSLPTFPTISELAAATAAVEAAAAATVSSPSVGG
PPPVRRASLPVQRTVSPAGSTAQSPKLAKITLNQRHSHAHAHALQLNSAPNSAASSPASA
DLQAGRLLQAPSQLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKNCPVD
KRRRNRCQFCRFQKCLVVGMVKEVVRTDSLKGRRGRLPSKPKSPQESPPSPPISLITALV
RSHVDTTPDPSCLDYSHYEEQSMSEADKVQQFYQLLTSSVDVIKQFAEKIPGYFDLLPED
QELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSRSLH
NLEIDISAFACLCALTLITERHGLREPKKVEQLQMKIIGSLRDHVTYNAEAQKKQHYFSR
LLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIENMFVTTLPF
>38E.4
MEADGEAQAKPEDEVETLGDLINGPGHICEKYTNGSRVRIGLVRSMGQRSLLILGQVFRF
FFSTATGNMAAWQLGNLATWQLGGFDAIAFEIHDSDKARLMA
>38E.5
MQMQDADANADIELTNYPWQKVSRHRYKKQLQHHAAQENNDNLPVDSSLSSDTQNGAKSI
RCDTTRTGWFTFTLIASGLPVASWVLAPSGRLFGLRRKPILIYANCCELATSIGRQHARN
AVKCDAEIIGIYLLLLIGSQNSLDLRIVGSHTVAIAVSASVSVSVAAALEMAKSSMLKAR
DKRICHSSKHHSLSNCDRAGAFRPLTVNWASQLGPQSQGEWDIECIRLASALTSRVLFAT
WQQPLATNSPAWLYRSPVNPKPRIVAVQSQGRHHFQVLWNRPSHKKKQTQSSDGKRRRVT
SRTSAGGVCVCFVYPGGIYKCEIIVGGPNKNKSREERTPNGRPWEPRESREALSGRNEGV
IGFNFRWQLLEKRGKESERERERESHGERAQPEIPRPSDDPDLALFHNDVTAPQQRREFP
GGVSVAYIYVQCARPVVYSLPFPVCPCDDYAIKLTTGRGSLGSSIFPCSVLFLHADRTFR
GPSVCQSNRCGSCNLAFQCLPHLQVRRRTRQRNAGWQTSCAPKHEINKPIDNVAGKNMEL
LATLLENLKCTHADIQSLHVREPPAARQSKLTNNQQPTTNNRQQSGQNKRKTRRGETVRK
ENLSAVQYLMSDELWRRLTEVLHSQAADHQMIMRMLLTWLVVLVVLLTAGGDGGGGGGGG
ALMTSSWQWLHPPTDSTFFWHATDGTSTTPRDLWTLHSMGREWKWHRNRNQNKPSRRMLA
EMQKHDR
>38E.6
MAMGAKSARHRMTNQSKTNRRRTYDQRHSTPLRKCKPSPLTPPCTPVSPEQLHLPRPVVT
FQVSFSLAKHMSKHTQTVAQVDRKALVG
>38E.7
MRDRLASLIVVKQEGGSNTSISHHQATAIKCEASLYTESSLFQEINNNSCYRQNLNAPTH
QQSHTSHLQHAQQHQTHQQHPLLPPPLPTLPLIYPCRNLFPDGCDINHLACCSSSNSNSN
CNSDSNSTSSSPGNSHFFANGNTCMYLVFPFGLSVLVTFSFFVFLYFPNSNAAVVFSSNS
LIAHAAYTQCAARIAKSAKKLTVCSIRLRRQVGKKSEKCNLNKKGGVAGGGRLDNAQ
>38E.8
MLVNNNEENNNNAKPVQIFSPKIGDTRLENGKPEDAASTALPASTAQRTGSKPRFLTVVS
VRTGDRGLCTWASPCGSRRQNVRSLSRPADCCVDRDRAERLGFLGAVALPFVFGYIFSHN
AFARVSRLWVRLTLRPIVAPGFLAVVDGAVAVPLAIMVVAEVEVVVVVPVVLVGLVVLLL
LADLLVAPKTATLKARTRTQPTPLSLRSNRHAIRQSAEGAIQRMSGMGHVVRLYIPKCID
LYQLIVQNRTEQDRELGQQLKGNMQSRCLPAAFVKLKLSAHTLPLEIRRMEFQGAAQSRG
TLTSPGTSSADNWPEMLAKRCSQSGWLDCLPSTCASNLQDSECGTVDRRVAAIAAADSHL
RSHSSVINWTRSLSFLLLTQTSSANKATKFSSNRAAIECEIYCRRSIAWIELNRGFRTVS
NIAYCSISVSIRLASKGPKCSDTTHTRLSAIIGVLMEHCEHCDDHKFRSSTSLWQPWGHD
SSIQ
>38E.9
MPKAKTHSRSVKTPFPVRSNRPGGVQKSEPSPSPSPLCRTSLLDLPEDIIRLVLEFLPRI
TDKVLLACVAPKFRAAFEGWARVQRNALDMVSLETVPLPQLIRFFKVAGPFIRVLQVDCA
SYQKESLLVEFVKEYCPNLEEISYSNATDEFHYRSIMSKMTHLKRVTIECLDAEDVLNFD
MQPNQELEFFELVNGCYTGQNLCGFPNLKTLVLRDCLLWNSMEFGIPLKSLHTLDLDDCC
FEVMNVSLYQKIAESCTNLVELIFSGCDTNFEVIANLPKLERCTLKTWMTSNELNIGFLT
VLAEKRGNKLTHLHLSGQFNITNEHARCLGQLSSLTDLRFSNNDILDDDHFKFFNDLSQL
ERFGLTACGRVMDVGMMRMLRKCPQLKVIDLTDCEQITEEFVIQAIGFCSKGSGRDVVLN
VKGTMIRRPILTVGKPGREFRKHILTLSYFAASGLREFLESSKG
>38E.10
MILLSGLLPLLGVVLLHLATPTQAFYLPGLAPVNFCKKTDVSSTCKSEILLYVNRLNTEE
SVIPYEYHHFDFCLGEEQNSPVENLGQVVFGERIRPGPYKIQFLENQQCATTCVKTYKGD
DPASNRRMMVLKKGISLNYQHHWIVDNMPVTWCYPLENGKQYCGIGFPMGCLVRSDGEGC
PINSIYNQPMHYYPFNHVDLEITYHSGQSEDWGIQFGNSGRIISVKVTPKSIKHTDKENP
NCLSTEPLAISENSLKAGEQLEIVYTYSVKFVKNDSIKWSSRWDYILESMPHTNIQWFSI
LNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSGEDAQEEFGWKLVHGDVFRPPRKGML
LSVFLGSGVQVLVMAMITLAFACLGFLSPANRGALMTCSMVLFVSLGTPAGYVSARIYKS
FGGLKWKSNVILTSIVCPGVVFSLFFVMNLVLWGENSSGAVPFSTLIALLALWFGVSVPL
TFVGAYFGFRKRALEHPVRTNQIPRQIPDQSIYTQPIPGIVMGGVLPFGCIFIQLFFILS
SLWSSQIYYMFGFLFLVFVILVITCSETTILLCYFHLCAEDYHWWWRSFLTSGFTAVYLF
IYCCHYFVTKLSIKDSASTFLYFGYTAIMVFLFFLLTGTIGFFACFWFIHIEDNDGDEYD
ELSELRQRHKPESQPSVDVHICETRSLIFSRFAVFFPGGLRSGRPSAHHWRIRQIPEALG
FRNLPARLHTLFMADTPDDYWCRIPELLDLPLEQRKSLSIPKELDNDELVYSKCYTYGVN
WTQLLESGEEDDLTTMEPNASWPLIKCPQGWEYNTSVVWSSIVIDFDLVCDQDIYPTIGL
AALNTGGPVGVYLFGLLNDRGGRRLSYFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLT
IPAVYQIPFIISLELVGENYRSFVTVMTCTFYTSGIMLLSGVTYLERDWVRLSYITSLPF
YAYFLYMFVMPESPRWLLMRGRLEEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKK
QKKKMANVGLADLCRTPNMRLKTILITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAV
VELPSYLCCWYFMDTWGRRWPLSLSMILGGVACVITVMLPDDAVDETLVLYLVSKALLSA
SFLIIYPFAGELYPTQVRGIGIGASSYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSML
GGMTGLRLPETLHHRLPQTIEEGEEFGKNWQFKDCCRCAQKPEILSQPASYENLDVLAGS
STNASEVELELRDSRRVREPAPRIDERTPLDTTASGSGRPVHRPSMKRLVRQMSVMDTQR
THDGTMQLTHWI
>38E.11
MTSDIAMQLIAILEKTVSPDKNELLSAKNFLEQAAASNLPEFLKALSEILVNTANSAVAR
MAAGLQLKNHLTSKDEKVSQQYQDRWHQFPSEIRELIKNNILAALGTENTRPSCAAQCVA
YVAVIELPINRWPMLIQTLVNKVVSEGSSEMHRESALEAIGYICQDIRFGVMENQSNDVL
TAIIHGMRKVEPSNHVRLAATTALHNSLEFTKSNFEKDMERNFIMEVVCEATQCQDSQIC
VAALQCLVKIMTLYYQYMEPYMAQALFPITLAAMKSDNDAVALQGIEFWSNVCDEEIDLA
IESQEATDQGRAPQRVSKHYARGALQFLTPVLVEKLTKQDECDDEDTWSPAKAASVCLMV
LATCCEDEIVPHVLPFIKENIESPNWRFRDAAVMTFGSVLNGLETNTLKPLVEQAMPTLI
RLMYDSSVIVRDTIAWTFGRICDIIPEAAINETYLQTLLECFVKSLKSEPRVAANVCWAF
IGLSDAAWEAAVTNDGETPETYALSPYFEYIITQLLETTDRSDGAQANLRCAAYQALMDM
IKNSPLDCYLVVQRTTLVILERLNQVMQMETQINNHSDRHQFNDLQSLLCATLQSVLRKV
HEQDAPQISDAIMTALLTMFNSSAGKSGVVQEEAFLAVSTLVELLGAQFAKYMPAFKDFL
VMGLKNFQEYQVCCAAVGLTGDIFRALKDLMVPYSNEIMTVLINNLTEPTIHRTVKPQVL
SAFGDIALSIGNHFLPYLSMVLDMLRVASNLQTDANNFDMNEYINELRESILEAYTGIIQ
GLKGVDQTAHTDVMHMEPHLMHIISFIKRIAQEGDVSDSMLASAAGFIGDLCTSFGPRLY
PLLDDAIITQFLAEGKRSKAQRTKMLCTWAVKEIKKINTQVITQ
>38E.12
MALGLCEGMKTTRSVVGVPPNTNRPPHPVRRPDSLLPISEEPKSISSQTPNMDSGNDSAR
PTPSPLAPTVSGISSLISTTFKPKDIMAFVEHLPTFDGTPRLLDRFITSVEEILMLIRGA
DQTPYGLLTLRTIRNKIIDRADEALELANTPLVWDEIKSNLIRLYSSKKSEANLLSELNT
FSDNLTLGQLFFGISKVRSQLFSILKNSEHNNTVVDAKKVVYNEVCLNAFMTGLKEPLKT
FVRIKSPSTLEQAYEQCQIEQTLYRAQNKRTNRPEQGPNGSDNKTYRNSYDSNYRSGRND
RNDRRGPYSNSNSNSNSGQNRPFNSHNRTPQSGTKDNRANTSNPFRAPSHSLNNIEENPQ
PDSNFQQTASGNQQVLKYIKTSLYHFHRNIKSSYSPWSAPVWVVPKKITPTGEQKWRLVI
DYRKLNEKTISDRYPIPNIADILDRLGKAKYFSTLDLASGFHQIEMNPDDTPKTAFTVEG
GHYEFIRMPFGLKNAPATFQRVMDNIFGDLIGTICLVYLDDIIIFSTSLQEHFIHLKTIF
GRLRSANFKVQLTKSYFLRRETEFLGHIVSQEGVRPNPNKIEAIKNFPCPHSKKSIKSFL
GLLGYYRKFIRDFARLTQPMTQKLRGNNKSIIIDDEFKKAFEYCKTLLSNDPILQYPDFT
KPFTLTTDASNFAIGAVLSQGPVHSDRPVCFASRTLSAAETNYSTIEKEMLAIIWAVQYF
RPYLFGRRFTIITDHKPLTWLMNFKQPNSKIVRWRLQLQEYDFEVVYKKGSQNVIADALS
RPEASVNHNEALSIPQNVCPISEKPLNDFNIQLLFKITPDTNNATLTPFKHKLRREFCKP
NFQYDDVVCILRQSLKPNKTCAVFAPDHIFQMVEQAYQTYFSAHSQFKLIRCLIFLPEIT
DSTEIEKIITDYHYNSNHRGIDETYLHIKRQQFFPHMKERITQLIRKCETCLKLKYDRQP
QKITYQISELPSKPLDILHIDIYTINKNYNLTIIDKFSKFAAAYPITNRNCINVVKALKH
FISQFGIPKKLIYDQGAEFASDMFNKFCTQFNIDLHVTSFQQSSSNSPVERLHSTLTEIY
RIILDVRKQQKLSSEHDEIMSETLITYNNAIHSATKHTPFELFNGRTHIFNQTIQFNNEH
DYLTKLNEFREKLYPLITDKLSNDVVRRTLKLNETRTDPVDLQPDTLVLRKENRRNKITP
RFSIHKVKHDKGHTLITARNQKLHKSKIRKTVLKKDKSNNAIHVHYLNDNAPIAKIELGK
ALLIERYKIISHVINLQDYSRCMEQFHLTINKFNPDSTLTDSVTILKTKLTQAQVKLKAL
TPSYRNKRGLINGLGSLVKVVTGNMDANDNKEIHEELDNIKKNSEVSNDNLQKQVMFNNE
ILIRFENITDHINNEQILISKFFDTSQNKIYKHLNLQDTLLEEIQYLNRINYNIELFINH
LNDITESMLLAKINIIPKFILNEQEMDKIKTILEKQNITVKNEQSIYNFLQMNTLNYEQK
IIFNIKVPIFKQPFHTLARLVPLPINNTYFVITPNYLAYNINNKKFHMTRKCPKLDNTFL
CDENFYVDTPQNNTCLEHLLNGENSSCDVRETGPITDVFEAERGYIFAFNVNKLKVSLTN
GSELSIMGSAIIRYINETIQINGIDYDGTVDTFPEQTDFDLPPMRKVTRNTTITVLSLEK
LHLEATQTMDKILAVHHNTIQHTWTLYTLLGLVTFLAVILWLHRRTKHIVHIHEDHHVPI
YASSIPSLWPSLRTGGGGVTTPPPKPPRL
>38E.13
MPLKGIRVLEFVGLAPGPFCGKILTDFGATVTRIDKVMENPLDVLQQGKRTLCLDLKNPK
GQQAVQRLVKKCDVLIEPFRPGVMEKLNLGPTDLCTANPRLIYARLTGFGQHGRLAQRAG
HDINYAALSGVLSMLGRRHEKVTAPINILADFAGGSLMCALGICLALLERHRSGKGQVVD
ASMVEGAAYVASWLFMSRNLVIWGRERGDNLVDGGSFFYDTYETKDGRYMSVGALEPQFF
EMLKQRLELPEDVSQFGEEHQVRGRKLLTEAFLSKTQAEWSQIFEDVDACVYPVLDYREV
HRHDHNIQRNSFEVTEDTATPRPAPVLSRTPGKLPKATDGAQVEWMDELDLKPDEFKDLL
DSGVLSLPERAKL
>38E.14
MPQQRRKVAFSGKKKKDQMLQKRNTKGPPKYLRSTQESYEDSDVPETTRKLMEQPFARGG
NRNKNVNRYNLQFYQEGKKELEQMKQEGFKPFEKLSPAQREVDDRYFAGCDFPVRPPWTL
TESKEELDRTENRYFKEYVDELQKKQRAGDSKELSLFELNLETWRQLWRVLEFSDILLII
VDVRYATLMFPPSLYDYIINTLKKHAIVVFNKVDLVEPHAVVAWRQYFRDRYPQLPVVLF
ASFLPRSRKGSQRGPQAHRRSMEGVYNIYKECQRYVQGEVDLTTWEQKIREDMRSDQLDI
LDEISTAVEGELKISSSIDTTPHEHVKYHSGVLTIGCIGFPNVGKSSLINALKGRKVVSV
SRTPGHTKHFQTIFLTPLVRLCDCPGLVFPSSTPKSLQVLLGSFPISQLAVPYRSLKFLG
EHLNLPQLLRLHLPEDYDEWSAVAISDAWAYKRGFLTAKAARPDRYRAANHILRMCLAGQ
QMLVLQFYPPGFEERREHWLQHPDVGEVKKYQQVELDEPESETNGDTSSVCSDTADSEDE
DEDSSNDETNADEEECGIREDAPRSRNVFALLEDD
>38E.15
MQRDRDSSGSNARKGNRPPGLRGKDIGLYYRNLARQQKKDRGENAESKEPQIRLGCNVSA
PSGVLERVKELMEDYSRAPSRQNVDDKNVDAKFQQQFRHLLSVNFEEFVAETKERNADLD
WVNPKLDERLQLELGQRQLEENAKKRLEARKKLPTMKYADDIIQAVRENQVILIVGSTGC
GKTTQVPQILLDDAISRGCASSCRIICTQPRRISAIAIAEWVSYERCESLGNSVGYQIRL
ESRKARERASITYCTTGVLLQQLQSDPLMHNLSVLILDEIHERSVETDLLMGLLKVILPH
RPDLKVILMSATVREQDFCDYFNNCPMFRIEGVMFPVKMLYLEDVLSKTNYEFQKFRDRR
PKRDPPERRMKHEAMIEPYLRRIRNSYDSRVLDKLRLPESEGCEDIDFIADLVYYICENE
PEGAILVFLPGYDKISQLYNILDKPKTSKGQRWRDHMAVFPLHSLMQSGEQQAVFRRPPA
GQRKVIISTIIAETSVTIDDVVYVINSGRTKATNYDIETNIQSLDEVWVTKANTQQRRGR
AGRVRPGICYNLFSRAREDRMDDIPTPEILRSKLESIILSLKLLHIDDPYRFLQTLINAP
NPEAIKMGVELLKRIEALDQTGTLTPLGMHLAKLPIDPQMGKMILMSALFCCLDPITSAA
AALSFKSPFYSPLGKESRVDEIKRRMARNMRSDHLMVHNTIIAYRDSRYSHAERDFCYKN
FLSSMTLQQLERMKNQFSELLYNYKKSRQIKNRVRAIHTMATDDGRRVNFHPSSVNSGES
GFDSAYFVYFQRQKSTDLFLLDSTMVFPMALIIFGDGVEAGVTQNTPYLCVAKTYYFKCN
RETADVVIQLRSNLEKLLLKKALYPAPIEENGYEKQLIKLVLTHVSLNNNNYVFISAQSH
RIASLARRKTRRGLYFIR
>38E.16
MSRHEKTKSTGGGLLDSLFGRPSKSKGGTISSGTLAHGGRPVSADNYVVPGVEDFEQYIQ
QLSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEK
PIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKLLARSKNNAS
YEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFC
IVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPKRDLACHSLIFINTLT
NTPTDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFKIFNEIREDDFEEFVQ
RFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECI
SQIVFHKGYCDPNFENRNFNIDTSLLLDDIVEKAKAKESKRSEEYEKKIEQLESAKQEAE
AKAAHLEEKVKLMEANGVAAPSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPP
PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLK
PKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQ
KDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNI
LQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMV
QDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNT
KDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLE
TDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYT
MEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMD
APQTQEGVMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSRTRVTNGQLMTR
EMILNEVLGSA
>38E.17
MHLLRDRLGVAGGRKGFLEGFGPANGRKTLKNVKRTDKQRMPHDNDTSTIHTYPSIHTQI
RLASTLHQATDIGNGVLHDLPVPGMRRGAQPYRAHGSYPSRPSPRSKFHRIVDGLRKRGK
NKSGLWLPNCCVNFMGRSMGRSTHQHHLTGLVWCPRSRATSTIASWFLYSGLWVAMAMVM
AKAIAFA
>38E.18
MSSANSDSADKETEPNIFPLQLVAIFDGLSWDRERYWYSERDPDQNRTTKPLKQKYTASA
SSDNRGCRFIATPRKLKWAFDVPCRHMPPHAAQTTENGPFIILSKITKSGLAAINANCMP
TDFMGLMDIGVIVDIVDIVVFIFPFLTCARVINREQMCKRILIKAHICTVRDGQGKARTA
RAWREDNAVHYVLGNMESSGSECSQADAGETQAQGGLLHPVEVWRLRWRCPVVVAHRIVI
VVVVMGGWAIVVVVVVVVVVGDGTQMVCQVMMRRRGRSRRPRARDFRARNGNRWRRQTFG
DVLLMVGWCGTWSSIGGPANTTATACSSDADAAVGLVELGRTRCTTATAAPGTGGTAGGM
GVMMVVLLHQLVGRRGHILNEVIRRARGGGRRRRVEHVMGVVVHLVGSGRVVGGMRGVHI
AQELVVRRRVVVVGRPVPWLARR
>38E.19
MAGGNFQQRNGVSKSQVLRFVCPNLRGAIDEIALSAGVRGLPPRHKTIALIFRQKNRLNS
SGADLWKARFSRVGPETTIRNQDVTGVMSSALSDKLTPSGCCLRVITEPSESNQLPPRTF
DEWGTATKAYRDKCPTIPELYSKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSEL
AQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHL
SHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAAVAAHSHQLQQQHSAQMSAAAAVGTLS
>38E.20
MNTIDKATQWNFNFLLGLIRVNVHSYAPPTKSNNNNKCGKRQSTNRPFSLPNRSPPHSAI
TVIGSTVGSLALTQIDIRVSLATAFRRQSEIIITSQLNLGNVCDYLCKCRCIKLSRNTTK
TTYNKAVVMSFKRSSSVILPQLQPSSSYLNWHPEEVARQSGSDPYGYKKKERYRIAPGLV
RHNAQSSRRPSAYSCSLFSDRRIPIPEPLTKRKPLAIQYQPSLKVQPAEVSVLNATGRVG
MPTEANCLNQLAHVHRLRDSELNYNEHQYNRNMQMLRNHEGLGVPLKMGMERFAARQVGR
LPFLSSSNFMDDVLTGRCDSIGFEDFMNLPENSEHMRQPHAVVEKSLGIYQ
>38E.21
MYRMQQVTRIEISKTFTGNHQNAQREVEYRTRLSQLLSSDICSISFSSGCVGVAALFGEQ
AYRARELRAFKSPRTKPDHIRSRMATDTTHNSEGNQNMSKTYTNGYFRKLVGTGGRSCCR
LLGWRLMEPKEAAADGRNVSRRLITGTDADADAASSFKMVRWSARSRRQARQDKVELLAR
NNKVNGEDDTSDNAAFRNSTDLSDHDEIFLKGLLRSNSNTPHKELMASRPEHINLVSQLV
ANSAKLNPTEPQPVPLFLPAHLNNKPICDDIIRKFSPSRRLESRELAKLLAQPHFRALLR
AHDEIGALYEQRLKAAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPS
KPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAK
ENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLP
CRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADYV
HKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRR
TLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNG
NLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADR
RATGSNRNLSATLVALLDLCLNTQTLLNTFAFYDFSEQDDDLVATVEESSFVQRKYEKYF
DMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY
>38E.22
MHLMPGDADFSESFAAWGQTEFQGKEEADADAPTKSPRERDGCTKIEREHESEASEKLLP
HMCSSLTHMEACCAQFSSRVYVWREGVKAGVWRGEPLDCASENSFYDDGHHTAFRHSLAD
ADNAAGTMMSMTSSPPATPTGVQTDSDGLILPKKLINPCMENIDRKELHRELKFNARVGK
SVLNQKSELQRAYDKQKERHAAAEQHSPDADIVGGIPGLKGELGRVIMERAQKHEAAAQK
QDQEDAEERQYVNPEYLNVRAKLRTAHANN
>38E.23
MISISTILALVVSSVWATDYTLEFEDSDLYSECSEKLPGAIGLREAFDMRNIVTELDIDG
LHLSGNCTTIWDVPSTDRISLRMTVMHFDRGTWQPTVFNTYARDFCAVMFDKELSWYKYW
LKYFANREEISEKCIGTKGTVLVYKPFIVKPLIQNVIGPIYRGRVKAIFNFESFDKNNVK
GATDVCFEVRGRINDLFSQGKMIRGLVILVLALANTWATDYNALIDDEGIYVKCSEAPAG
TLGPRDVFNIDNMVMHMEPEGIYVSGNMTVKLNFLPSDRISARFSVMHYERGSWQPTMFN
LHSPNFCEVMFDEDQYWFKYWFRYIRNKEEIREKCLKVKDTVLVYDEFLMVLHLENVNTS
NLQGRYKAVITLEAFDEHNVRRPSSLCVEIRGDLERKTQFTIDKMNRKHNKISHSGSHMH
GIKVEPKKYSPQEYREKILSLFPLPPRPANMCHDAFVKKLLEPYVLETKEVVRAVKMTRD
STGEDSSEDTYEAFRAKMYKTNYTARATVYMARATILARTSVKSILSPEQRDSAAQTTQM
FKVRFANLISDFRNVCIIYQLLQLQEILNVMREYPPAGTNPNDTIFGWSYKENLKRFEQQ
PSTVYVDILEKNKPEATLDDLKFYVDLGELIGLVQALLDDVIHDRDLCAPNGFMELLKDT
QVDIDKLIALPYETIMAEHDSLLEEKEKKNRVGKFHNPKLTAKQHALNKERFQIDYMSPI
ESRYKVNWTHDVVDQGQYIDFLRCKVLSDELEKIEELMRTDSSVWRSCHLEYVTLIEQYK
QRINKIQQDYDDDMETAENKLQATLNRVGKCKEDLRSCQEKVEEFHVKIEEVREKIAKEV
EKERARLSAARVSKRMSRILARQKEEKKAAAQQAKLDKKLARQNKKSQE
>38E.24
MLSFREPENRERQRRTANTPLNSGSIIMKTARNARAEKRQQAAVFCRIGFYLWAALSRSR
SCSRCSSFLFCPFCPCRFVVFVISMSVCPVPLTRTVEYVWVFGVSPYELRISLDVIYEFL
ITAYFVVLFALLTLVLITWLPIWVGLMIDKLSLMSSDTKKKAATPASYLKRKSRARHSIR
FLARSSRSVKGKPGYNERTVYLGELYLQDVDLISF
DOI
Related Publication(s)
Research paper

Map position and expression of the genes in the 38 region of Drosophila.
Butler et al., 2001, Genetics 158(4): 1597--1614 [FBrf0138405]

Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference