5bp deletion producing a frameshift at amino acid position 165 resulting in the insertion of 35 new codons (AYKGPKRCDNPISASICSVFFQTSLFKCSIFESKP) before the new stop codon located in the catalytic domain.
Pten117 mutant adult wings are slightly more elongated along the proximal-distal axis the wild-type ones.
Pten117/Pten2L100 mutant larvae and adult flies are larger than wild-type controls under normal food conditions. The prospective adult tissues, the eye and wing imaginal discs are larger than in controls. These larvae are highly sensitive to a reduction in yeast content, and although still larger, they do not survive to pupariation when reared on 10g/l yeast food. Pten117/Pten2L100 mutant larvae reared on 100g/l yeast food at 39% larger than controls reared on 100g\l yeast food.
Pten117 imaginal disc clones are enlarged in larvae fed with yeasted food but do not severely impact on the structure of the imaginal discs and of the adult eyes. Under mild starvation conditions (30g/l yeast), Pten117 mutant clones are further increased in size, resulting in an overall increase in disc size as compared to discs harboring control clones. Reducing the yeast concentration to 20g/l and below leads to a massive size increase in the Pten117 clones and to a concomitant reduction of the surrounding tissue. Furthermore, the Pten117 clones fuse and render the discs a lobed appearance. At 5g/l yeast concentration, the eye discs with Pten117 mutant tissue are severely overgrown with polyp-like structures protruding from the discs. The resulting adult eyes display strong malformations and outgrowths, indicating a loss of epithelial integrity. In some cases, no clones can be recovered in the adult eyes, probably due to a collapse of the Pten117 clones resulting in melanized scars. Tangential eye sections do not reveal any structural defects in ommatidial arrangement. Pten117 mutant cells overgrow in a cell-autonomous manner as the enlarged ommatidia are exclusively composed of mutant cells. The overgrowth phenotype of Pten117 clones is not specific to the eye; it is observed in other imaginal tissues like the wing disc. As the Pten117 clones are overgrown after only 36hrs post induction, developmental delay is not the cause of the overgrowth.
Pten117 mutant eye clones exhibit overgrowth. The entire eye is enlarged in flies raised on normal food. Under starvation conditions, the mutant tissue occupies most of the adult eye and the wild-type tissue is severely reduced. This over-representation of the mutant tissue results in an absolute increase of eye size under starvation as compared to normal food conditions. In eyes almost entirely composed of Pten117 mutant tissue, the eye size increase is mainly caused by larger ommatidia (+27%), and to a minor extent by more ommatidia (+14%). Under starvation conditions (10g/l yeast), the ommatidial size is roughly proportionally reduced in wild-type and Pten117 mutant eyes. While the ommatidia number is decreased by 6% in wild-type eyes, it is massively decreased in Pten117 mutant eyes (+44%). Since the composition of the Pten117 mutant ommatidia remains unchanged, the size and number of ommatidia reflects cell size and cell number, indicating a switch from hypertrophy to hyperplasia.
Whereas only a few apoptotic cells are detected in heterozygous Pten117 cells under both fed and starving conditions, increased levels of apoptosis are observed within overgrowing Pten117 clones.
When transferred from starvation (10g/l yeast) to normal food (100g/l yeast) within the first 72 hours, Pten117 imaginal disc clones, the overgrowth of the mutant clones is efficiently rescued. Later shifts are no longer effective in suppressing the overgrowth. It is sufficient to transfer larvae within the first 48 hours from normal to starvation food to produce the overgrowth phenotype. After this time point, Pten117 imaginal disc clones do not acquire the full growth advantage over the surrounding tissue.
Under severe starvation (5g/l yeast content), the Pten117 mutant polyp-like structures outgrowing from the eye discs exhibit very high levels of apoptosis. Scars are visible, in the corresponding adult eyes, left behind by the collapsing clones. These eyes contain more wild-type cells, indicating that the lost Pten117 mutant tissue is compensated for.
A decrease in shoulder area (as a measure for body size) is observed under starvation but not under control conditions in fly heads mostly composed of Pten117 mutant clones. Consistently, the wing size and the fat body nuclear size are reduced, especially in animals raised under starvation conditions. Thus, the growth-reducing non-autonomous effect of Pten mutant tissue acts systemically.
Head capsule enlarged - bighead phenotype.
Pten2L100/Pten117 larvae, pupae and adults are substantially increased in size compared to control larvae. Mosaic flies in which the head is composed of homozygous Pten117 cells (clones generated using the "eyFLP" system) have disproportionally large heads. Pten2L100/Pten117 adults are hypersensitive to starvation conditions compared to wild type.
Somatic clones of Pten117 in the developing eye cause strong overgrowth of the eye. The size of ommatidia in clones is increased relative to wild-type.
Generation of flies in which the eye imaginal disc is homozygous for Pten117 (using the "ey-Flp" system) results in an increase in eye and head size compared to wild type. The increase in eye size is due to an increase in cell number and cell size as indicated by an increase in number and size of ommatidia.
Loss of Pten function in the eye and head capsule results in a fly with a big head.
Pten117 has increased cell size | third instar larval stage phenotype, enhanceable by RhebEP50.084-loxP/Scer\GAL4Tub.PU
Pten117 has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by sev4/sev4
Pten117 has increased cell death | somatic clone phenotype, enhanceable by slifUY681/Scer\GAL4Act5C.PP
Pten117 has increased cell growth rate phenotype, enhanceable by ImpL2UAS.cHa/Scer\GAL4Act5C.PP
Pten117 has increased body size phenotype, enhanceable by ImpL2UAS.cHa/Scer\GAL4Act5C.PP
Pten117 has increased cell growth rate | somatic clone phenotype, enhanceable by ImpL2UAS.cHa/Scer\GAL4Act5C.PP
Pten117, mTor2L19 has increased cell growth rate | somatic clone phenotype, enhanceable by ImpL2UAS.cHa/Scer\GAL4Act5C.PP
Pten117, Scer\GAL4repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by btl::Egfrλ.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by btl::Egfrλ.UAS, Scer\GAL4repo.PU
Pten117 has abnormal neuroanatomy | adult stage | somatic clone phenotype, non-enhanceable by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117, Scer\GAL4Act5C.PP, slifUY681 has increased cell death | somatic clone phenotype, non-enhanceable by Atg5RNAi.UAS, Scer\GAL4Act5C.PP
Pten117, Scer\GAL4Act5C.PP, slifUY681 has increased cell growth rate | somatic clone phenotype, non-enhanceable by Atg5RNAi.UAS, Scer\GAL4Act5C.PP
Pten117 has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/PfkGD1508
Pten117 has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/PykGD16178
Pten117 has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/Pdha1GD12103
Pten117 has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/LdhGD6887
Pten117 has increased cell size | third instar larval stage phenotype, suppressible | partially by Df(2L)FASNΔ24-23/Df(2L)FASNΔ24-23
Pten117, RhebEP50.084-loxP, Scer\GAL4Tub.PU has increased cell size | third instar larval stage phenotype, suppressible | partially by Df(2L)FASNΔ24-23/Df(2L)FASNΔ24-23
Pten2L100/Pten117 has increased body size | pupal stage phenotype, suppressible by Scer\GAL4da.PU/Hsap\PTENUAS.cPa
Pten2L100/Pten117 has increased body weight | adult stage phenotype, suppressible by Scer\GAL4da.PU/Hsap\PTENUAS.cPa
Pten117 has abnormal neuroanatomy | somatic clone | adult stage phenotype, suppressible | partially by baboQ302D.UAS/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has increased cell death | somatic clone phenotype, suppressible by bskDN.UAS/Scer\GAL4Act5C.PP
Pten117 has increased cell death | somatic clone | nutrition conditional phenotype, suppressible by bskDN.UAS/Scer\GAL4Act5C.PP
Pten117 has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by bskDN.UAS/Scer\GAL4Act5C.PP
Pten117 has increased cell growth rate | somatic clone phenotype, suppressible by InR05545
Pten117 has increased cell growth rate | nutrition conditional phenotype, suppressible by Akt1
Pten117 has increased cell growth rate phenotype, suppressible by Akt1
Pten117 has increased cell growth rate | nutrition conditional phenotype, suppressible by Akt3
Pten117 has increased cell growth rate phenotype, suppressible by Akt3
Pten117 has increased cell growth rate | nutrition conditional phenotype, suppressible by gigUAS.cTa/Tsc1UAS.cTa/Scer\GAL4GMR.PU
Pten117 has increased cell growth rate phenotype, suppressible by gigUAS.cTa/Tsc1UAS.cTa/Scer\GAL4GMR.PU
Pten117 has increased cell growth rate phenotype, suppressible by mTor2L19
Pten117 has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by Ilp2UAS.cBa/Scer\GAL4ey.PU
Pten117 has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by Tsc1Q87X
Pten117 has visible | somatic clone phenotype, suppressible by foxo25
Pten117 has increased body size | recessive | somatic clone phenotype, suppressible by lilli4U5
Pten117 has abnormal neuroanatomy | somatic clone | adult stage phenotype, non-suppressible by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has increased cell size | somatic clone phenotype, non-suppressible by S6kl-1/S6kl-1
Pten117/Pten117 is an enhancer of increased cell size | third instar larval stage phenotype of RhebEP50.084-loxP, Scer\GAL4Tub.PU
Pten117 is an enhancer of abnormal neuroanatomy | third instar larval stage phenotype of Scer\GAL4repo.PU, btl::Egfrλ.UAS
Pten117 is an enhancer of abnormal neuroanatomy | adult stage | somatic clone phenotype of Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of neoplasia | adult stage | somatic clone phenotype of Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of neoplasia | third instar larval stage phenotype of Scer\GAL4repo.PU, btl::Egfrλ.UAS
Pten117 is an enhancer of neoplasia | adult stage | somatic clone phenotype of Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117/Pten117 is a suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTor2L1
Pten117/Pten[+] is a suppressor | partially of abnormal size | adult stage phenotype of IdeUAS.cGa, Scer\GAL4Bx-MS1096-KE
Pten117/Pten[+] is a suppressor | partially of abnormal size | adult stage phenotype of IdeUAS.cGa, Scer\GAL4en-e16E
Pten117/Pten[+] is a suppressor of abnormal size phenotype of IdeGD6073, Scer\GAL4en-e16E
Pten117/Pten117 is a suppressor of decreased body size | somatic clone phenotype of Pi3K21Bunspecified
Pten117 is a suppressor of decreased body size | recessive | somatic clone phenotype of lilli4U5
Pten117/Pten117 is a non-suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTorΔP
Pten117/Pten117 is a non-suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTor2L19
Pten2L100/Pten117 is a non-suppressor of lethal phenotype of Pi3K92Eunspecified
Pten117/Pten117 is a non-suppressor of decreased body size | somatic clone phenotype of Pi3K92Eunspecified
Pi3K21Bunspecified, Pten2L100/Pten117 has viable phenotype
Pten117 has larval fat cell | third instar larval stage | somatic clone phenotype, enhanceable by RhebEP50.084-loxP/Scer\GAL4Tub.PU
Pten117 has distal medullary amacrine neuron Dm8a | adult stage | somatic clone phenotype, enhanceable by sev4/sev4
Pten117 has dendrite | adult stage | somatic clone phenotype, enhanceable by sev4/sev4
Pten117, Scer\GAL4repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has adult brain | somatic clone phenotype, enhanceable by Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by btl::Egfrλ.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has adult brain | somatic clone phenotype, enhanceable by btl::Egfrλ.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by btl::Egfrλ.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117, Scer\GAL4repo.PU has adult brain | somatic clone phenotype, enhanceable by Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117 has distal medullary amacrine neuron Dm8a | adult stage | somatic clone phenotype, non-enhanceable by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has dendrite | adult stage | somatic clone phenotype, non-enhanceable by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/FASN1GD14739
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/Pdha1GD12103
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/LdhGD6887
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/PykGD16178
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4da.PU/PfkGD1508
Pten117 has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Df(2L)FASNΔ24-23/Df(2L)FASNΔ24-23
Pten117, RhebEP50.084-loxP, Scer\GAL4Tub.PU has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Df(2L)FASNΔ24-23/Df(2L)FASNΔ24-23
Pten117 has distal medullary amacrine neuron Dm8a | somatic clone | adult stage phenotype, suppressible | partially by baboQ302D.UAS/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has dendrite | somatic clone | adult stage phenotype, suppressible | partially by baboQ302D.UAS/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has eye | somatic clone phenotype, suppressible by bskDN.UAS/Scer\GAL4Act5C.PP
Pten117 has eye | somatic clone | nutrition conditional phenotype, suppressible by bskDN.UAS/Scer\GAL4Act5C.PP
Pten117 has eye | somatic clone phenotype, suppressible by InR05545
Pten117 has eye phenotype, suppressible by gigUAS.cTa/Tsc1UAS.cTa/Scer\GAL4GMR.PU
Pten117 has eye | somatic clone phenotype, suppressible by slifUY681/Scer\GAL4Act5C.PP
Pten117 has eye | somatic clone | nutrition conditional phenotype, suppressible by Ilp2UAS.cBa/Scer\GAL4ey.PU
Ptendj189/Pten117 has rhabdomere phenotype, suppressible by Akt1/Akt3
Pten117 has adult head capsule | somatic clone phenotype, suppressible by foxo25
Pten117 has adult head phenotype, suppressible by mTorEP2353
Pten117 has distal medullary amacrine neuron Dm8a | somatic clone | adult stage phenotype, non-suppressible by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has dendrite | somatic clone | adult stage phenotype, non-suppressible by baboDN.UAS.cUa/Scer\GAL4DIP-γ-MI03222-GAL4
Pten117 has eye | somatic clone phenotype, non-suppressible by S6kl-1/S6kl-1
Pten117 has ommatidium | somatic clone phenotype, non-suppressible by S6kl-1/S6kl-1
Pten117/Pten117 is an enhancer of larval fat cell | third instar larval stage | somatic clone phenotype of RhebEP50.084-loxP, Scer\GAL4Tub.PU
Pten117 is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Scer\GAL4repo.PU, btl::Egfrλ.UAS
Pten117 is an enhancer of adult brain | somatic clone phenotype of Scer\GAL4repo.PU, btl::Egfrλ.UAS
Pten117 is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of adult brain | somatic clone phenotype of Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of adult optic lobe | adult stage | somatic clone phenotype of Egfr2.A887T.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of adult brain | somatic clone phenotype of Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117 is an enhancer of adult optic lobe | adult stage | somatic clone phenotype of Ras85DV12.UAS, Scer\GAL4repo.PU
Pten117/Pten117 is a suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTor2L1
Pten117/Pten[+] is a suppressor | partially of wing phenotype of IdeUAS.cGa, Scer\GAL4Bx-MS1096-KE
Pten117/Pten[+] is a suppressor | partially of wing phenotype of IdeUAS.cGa, Scer\GAL4en-e16E
Pten117/Pten[+] is a suppressor of wing blade posterior compartment phenotype of IdeGD6073, Scer\GAL4en-e16E
Pten117/Pten117 is a suppressor of eye | somatic clone phenotype of Rheb2D1
Pten117/Pten117 is a suppressor of ommatidium | somatic clone phenotype of Rheb2D1
Pten117/Pten117 is a non-suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTorΔP
Pten117/Pten117 is a non-suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTor2L19
Pten117, mTor2L1 has larval fat cell | third instar larval stage | somatic clone - Minute background phenotype
Expression of bskDN.Scer\UAS in Pten117 eye clones (using the MARCM system) efficiently blocks apoptosis and enhanced the overgrowth phenotype.
A InR05545 mutant background only slightly reduces the overgrowth found in Pten117 mutant eye clones.
An Akt11 or Akt13 mutant background completely suppresses the Pten117 overgrowth phenotype, under normal as well as under starvation conditions.
Reduction of TORC1 through expression of Tsc1Scer\UAS.cTa and gigScer\UAS.cTa (under the control of Scer\GAL4GMR.PU) suppresses the overgrowth of Pten117 mutant tissue.
Eyes mutant for Pten117 and Tor2L19 are reduced to the size of control eyes at both fed and starved conditions, indicating that the overgrowth of Pten117 clones depends on normal TORC1 function.
Expression of slifUY681 in Pten117 mutant clones results in a slight reduction of the mutant tissue under normal conditions. Under starvation conditions (10g/l yeast), these double mutant cells are almost completely eliminated. This loss of Pten117 mutant tissue is accompanied by a massive increase in apoptosis. The structure of adult eyes in these mutants are wild-type, indicating that the surrounding tissue is able to compensate for the loss of the clones.
Knockdown of Atg5, through expression of Atg5dsRNA.Scer\UAS, does not impact on the initial growth of Pten117 clones with reduced slif function (through expression of slifUY681).
Expression of Ilp2Scer\UAS.cBa under the control of Scer\GAL4ey.PU suppresses the overgrowth found in Pten117 mutant clones under starvation conditions. Furthermore, expression of Ilp2Scer\UAS.cBa restores the growth of both the tissue surrounding the Pten117 clone and peripheral tissue.
The introduction of Tsc1Q87X clones into the neighborhood of Pten117 clones reduces the overgrowth phenotype, under starvation conditions. Thus, even when neighboring with a tissue that also has a growth advantage, Pten clones themselves experience competition for common resources.
The generation of Pten117 and Tor2L19 sister clones results in eyes that are completely composed of Pten mutant tissue. However, these eyes are smaller than those without Tor2L19 mutant sister clones.
Ubiquitous expression of ImpL2Scer\UAS.cHa (under the control of Scer\GAL4Act5C.PP) results in the overgrowth of Pten117 clones, irrespective of whether they neighbor Tor2L19 mutant or wild-type cells. The overgrowth of Pten117 clones causes a further reduction in body size, as evidenced by decreased shoulder width.
Ras85DV12.Scer\UAS Pten117 double mutant clones generated under the control of Scer\GAL4repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.
Ras85DV12.Scer\UAS Pten117 double mutant optic lobe clones generated using eyFLP under the control of Scer\GAL4repo.PU contain more excess glial cells than in either mutant alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.
Egfr2.A887T.Scer\UAS Pten117 double mutant clones generated under the control of Scer\GAL4repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.
Egfr2.A887T.Scer\UAS Pten117 double mutant clones generated using eyFLP under the control of Scer\GAL4repo.PU contain more excess glial cells than in either mutant alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.
btl::EgfrScer\UAS.T:λ\cI-DD Pten117 double mutant clones generated under the control of Scer\GAL4repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.
btl::EgfrScer\UAS.T:λ\cI-DD Pten117 double mutant clones generated using eyFLP under the control of Scer\GAL4repo.PU contain more excess glial cells than in Pten117 alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.
The small rough eye phenotype see in flies with Rheb2D1 somatic clones throughout the eye disc generated using Scer\FLP1ey.PN and Scer\FRT, is largely suppressed by Pten117/Pten117.
Expression of BacA\p35Scer\UAS.cHa in Pten117 eye clones (using the MARCM system) efficiently blocks apoptosis and enhanced the overgrowth phenotype.
Expression of BacA\p35Scer\UAS.cHa in the dorsal half of the eye under the control of Scer\GAL4mirr-DE blocks apoptosis, results in Pten117 clones overgrowing even more in the dorsal compartment.
Blocking apoptosis, through expression of BacA\p35Scer\UAS.cHa in Pten117 clones with diminished slif function (through expression of slifUY681), delays the collapse of the clones but they are absent from adult eyes.